SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1cvdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cvdA
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.05e-141
Family Carbonic anhydrase 0.0000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cvdA   PDB: 1cvd   SUPERFAMILY: 1cvdA
Sequence length 255
Comment (A:)
Sequence
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelclvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf
Download sequence
Identical sequences 1cvd_A 000044437|e1cvdA1|62.1.1.1|A:1-255 cath|current|1cvdA00/5-260 d1cvda_ 1cvdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]