SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1d4dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d4dA
Domain Number 1 Region: 123-382,509-571
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.45e-67
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000676
Further Details:      
 
Domain Number 2 Region: 361-505
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.95e-44
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000839
Further Details:      
 
Domain Number 3 Region: 10-94
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.01e-16
Family Di-heme elbow motif 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d4dA   PDB: 1d4d
Sequence length 572
Comment (A:)
Sequence
aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdlq
yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektakpitglyaagevtggv
hganrlggnaisdivtygriagasaakfakdn
Download sequence
Identical sequences 1d4dA 1d4d_A 1d4e_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]