SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1d5tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d5tA
Domain Number 1 Region: 3-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.9e-67
Family GDI-like N domain 0.0000000000643
Further Details:      
 
Domain Number 2 Region: 391-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000163
Family GDI-like N domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d5tA   PDB: 1d5t
Sequence length 433
Comment (A:)
Sequence
hhmdeeydvivlgtgltecilsgimsvngkkvlhmdrnpyyggesssitpleelykrfql
legppetmgrgrdwnvdlipkflmangqlvkmllytevtryldfkvvegsfvykggkiyk
vpstetealasnlmgmfekrrfrkflvfvanfdendpktfegvdpqntsmrdvyrkfdlg
qdvidftghalalyrtddyldqpcletinriklyseslarygkspylyplyglgelpqgf
arlsaiyggtymlnkpvddiimengkvvgvksegevarckqlicdpsyvpdrvrkagqvi
riicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiasttve
ttdpekevepalgllepidqkfvaisdlyepiddgsesqvfcscsydatthfettcndik
diykrmagsafdf
Download sequence
Identical sequences 1d5t_A 1d5tA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]