SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1d7yA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d7yA
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.19e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000182
Further Details:      
 
Domain Number 2 Region: 147-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.5e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000582
Further Details:      
 
Domain Number 3 Region: 310-402
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.86e-25
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d7yA   PDB: 1d7y
Sequence length 408
Comment (A:)
Sequence
MSQEALKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGD
AEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRALPTLQ
GATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRL
MSRAAPATLADFVARYHAAQGVDLRFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLAN
DALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIA
VARHLVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTLIELQKG
RIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAAAVAA
Download sequence
Identical sequences E7FJB9 Q52437
WP_043565528.1.5072 WP_043565528.1.71962 WP_043565528.1.80432 1d7y_A 1f3p_A 2gqw_A 2gr0_A 2gr1_A 2gr2_A 2yvf_A 2yvg_A 2yvj_A 2yvj_P 1d7yA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]