SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1d8dB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1d8dB
Domain Number 1 Region: 19-419
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.33e-137
Family Protein prenyltransferases 0.000000000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1d8dB   PDB: 1d8d   SUPERFAMILY: 1d8dB
Sequence length 437
Comment (B:)
Sequence
MASSSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ
IVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQY
LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY
SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF
YHTCYCLSGLSIAQHFGSGAMLHDVVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPV
PGFEECEDAVTSDPATD
Download sequence
Identical sequences Q02293
1d8d_B 1d8e_B 1fpp_B 1ft1_B 1jcr_B 1jcs_B 1kzo_B 1kzp_B 1o5m_B 1qbq_B 1sa5_B 1tn7_B 1tn8_B 3dpy_B 3e30_B 3e32_B 3e33_B 3e34_B 3ksl_B 3ksq_B GO.102538 ENSRNOP00000010588 ENSRNOP00000010588 10116.ENSRNOP00000010588 NP_742031.1.100692 NP_742031.1.4139 1d8dB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]