SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1dbqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dbqA
Domain Number 1 Region: 7-280
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.58e-119
Family L-arabinose binding protein-like 0.00000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dbqA   PDB: 1dbq   SUPERFAMILY: 1dbqA
Sequence length 289
Comment (A:)
Sequence
slkvnhtksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmma
qkrvdgllvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagry
lierghreigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqq
ilsqphrptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihq
pkdslgetafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
Download sequence
Identical sequences 1dbqA 1dbq_A 1dbq_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]