SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ddbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ddbA
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 4.9e-81
Family Bcl-2 inhibitors of programmed cell death 0.0000000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ddbA   PDB: 1ddb   SUPERFAMILY: 1ddbA
Sequence length 195
Comment (A:)
Sequence
mdsevsngsglgakhitdllvfgflqssgctrqelevlgrelpvqayweadledelqtdg
sqasrsfnqgriepdsesqeeiihniarhlaqigdemdhniqptlvrqlaaqfmngslse
edkrnclakaldevktafprdmendkamlimtmllakkvashapsllrdvfhttvnfinq
nlfsyvrnlvrnemd
Download sequence
Identical sequences 000051364|e1ddbA1|5000.3.1.4|A:1-195 cath|current|1ddbA00/1-195 d1ddba_ 1ddb_A 1ddbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]