SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1djqA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1djqA
Domain Number 1 Region: 3-338
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.41e-87
Family FMN-linked oxidoreductases 0.0000000000386
Further Details:      
 
Domain Number 2 Region: 342-532
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.69e-28
Family N-terminal domain of adrenodoxin reductase-like 0.000000125
Further Details:      
 
Domain Number 3 Region: 495-675
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.81e-27
Family C-terminal domain of adrenodoxin reductase-like 0.000000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1djqA   PDB: 1djq
Sequence length 729
Comment (A:)
Sequence
ardpkhdilfepiqigpktlrnrfyqvphaigagsdkpgfqsahrsvkaeggwaalntey
csinpesddthrlsariwdegdvrnlkamtdevhkygalagvelwyggahapnmesratp
rgpsqyasefetlsyckemdlsdiaqvqqfyvdaakrsrdagfdivyvygahsylplqfl
npyynkrtdkyggslenrarfwletlekvkhavgsdcaiatrfgvdtvygpgqieaevdg
qkfvemadslvdmwditigdiaewgedagpsrfyqqghtipwvklvkqvskkpvlgvgry
tdpekmieivtkgyadiigcarpsiadpflpqkveqgryddirvcigcnvcisrweiggp
pmictqnatageeyrrgwhpekfrqtknkdsvlivgagpsgseaarvlmesgytvhltdt
aekigghlnqvaalpglgewsyhrdyretqitkllkknkesqlalgqkpmtaddvlqyga
dkviiatgarwntdgtnclthdpipgadaslpdqltpeqvmdgkkkigkrvvilnadtyf
mapslaeklataghevtivsgvhlanymhftleypnmmrrlhelhveelgdhfcsriepg
rmeiyniwgdgskrtyrgpgvsprdantshrwiefdslvlvtgrhsectlwnelkarese
waendikgiyligdaeaprliadatftghrvareieeanpqiaipykretiawgtphmpg
gnfkieykv
Download sequence
Identical sequences 1djq_A 1djq_B 1djqA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]