SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1dmyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dmyA
Domain Number 1 Region: 1-240
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.27e-130
Family Carbonic anhydrase 0.0000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dmyA   PDB: 1dmy   SUPERFAMILY: 1dmyA
Sequence length 248
Comment (A:)
Sequence
catgtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisg
gplgnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgengl
avigvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttp
plaesvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr
ldrtkmrs
Download sequence
Identical sequences 1dmyA 1dmx_A 1dmx_B 1dmy_A 1dmy_B cath|current|1dmxA00/25-261 cath|current|1dmxB00/25-261 cath|current|1dmyA00/25-261 cath|current|1dmyB00/25-261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]