SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1drjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1drjA
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.22e-111
Family L-arabinose binding protein-like 0.0000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1drjA   PDB: 1drj   SUPERFAMILY: 1drjA
Sequence length 271
Comment (A:)
Sequence
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiartsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq
Download sequence
Identical sequences d1drja_ 1drjA 1drj_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]