SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1dvpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dvpA
Domain Number 1 Region: 10-142
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.79e-54
Family VHS domain 0.0000157
Further Details:      
 
Domain Number 2 Region: 156-217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4e-33
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dvpA   PDB: 1dvp
Sequence length 220
Comment (A:)
Sequence
mfrssfcknlenatshlrlepdwpsillicdeinqkdvtpknafaaikkkmnspnphssc
ysllvlesivkncgapvheevftkencemfssflestphenvrqkmlelvqtwayafrss
dkyqaikdtmtilkakghtfpelreadamftadtapnwadgrvchrcrveftftnrkhhc
rncgqvfcgqctakqcplpkygiekevrvcdgcfaalqrg
Download sequence
Identical sequences 1dvpA 1dvp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]