SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1dxlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dxlA
Domain Number 1 Region: 351-460
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.18e-69
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000795
Further Details:      
 
Domain Number 2 Region: 6-373
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-66
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dxlA   PDB: 1dxl
Sequence length 470
Comment (A:)
Sequence
asgsdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhss
hmyheakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkf
vspseisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkkl
vvigagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktk
vvgvdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgril
vnerfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpe
vasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimap
nageliheaaialqydassediarvchahptmseaikeaamatydkpihi
Download sequence
Identical sequences 1dxlA 1dxl_A 1dxl_B 1dxl_C 1dxl_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]