SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1dxyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1dxyA
Domain Number 1 Region: 102-299
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.35e-55
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000000625
Further Details:      
 
Domain Number 2 Region: 2-128
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 6.54e-32
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1dxyA   PDB: 1dxy
Sequence length 333
Comment (A:)
Sequence
MKIIAYGARVDEIQYFKQWAKDTGNTLEYHTEFLDENTVEWAKGFDGINSLQTTPYAAGV
FEKMHAYGIKFLTIRNVGTDNIDMTAMKQYGIRLSNVPAYSPAAIAEFALTDTLYLLRNM
GKVQAQLQAGDYEKAGTFIGKELGQQTVGVMGTGHIGQVAIKLFKGFGAKVIAYDPYPMK
GDHPDFDYVSLEDLFKQSDVIDLHVPGIEQNTHIINEAAFNLMKPGAIVINTARPNLIDT
QAMLSNLKSGKLAGVGIDTYEYETEDLLNLAKHGSFKDPLWDELLGMPNVVLSPHIAYYT
ETAVHNMVYFSLQHLVDFLTKGETSTEVTGPAK
Download sequence
Identical sequences A0A0C9QSN2 A0A0E2BVW2 A0A0E2LU14 A0A1F1JTJ8 A0A1V0Q6V2 A0A2I5MF08 K6RFB4 P17584 S2Q7I0
1dxyA 1dxy_A WP_003577354.1.13963 WP_003577354.1.1450 WP_003577354.1.16871 WP_003577354.1.22898 WP_003577354.1.26583 WP_003577354.1.44983 WP_003577354.1.45488 WP_003577354.1.46604 WP_003577354.1.56814 WP_003577354.1.6012 WP_003577354.1.64430 WP_003577354.1.65183 WP_003577354.1.67371 WP_003577354.1.6844 WP_003577354.1.73866 WP_003577354.1.74597 WP_003577354.1.80634 WP_003577354.1.86624 WP_003577354.1.90364 WP_003577354.1.91063 WP_003577354.1.92090 WP_003577354.1.98013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]