SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ec6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ec6A
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.37e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ec6A   PDB: 1ec6   SUPERFAMILY: 1ec6A
Sequence length 87
Comment (A:)
Sequence
mkelveiavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
atqaaqylisqrvtyeqgvrasnpqkv
Download sequence
Identical sequences 1ec6_A 1ec6_B 1ec6A cath|current|1ec6A00/4-90 cath|current|1ec6B00/4-87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]