SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1fcdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fcdA
Domain Number 1 Region: 115-255
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.02e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000104
Further Details:      
 
Domain Number 2 Region: 3-152
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.05e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000396
Further Details:      
 
Domain Number 3 Region: 329-401
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.43e-23
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000703
Further Details:      
 
Domain Number 4 Region: 228-325
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000986
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fcdA   PDB: 1fcd
Sequence length 401
Comment (A:)
Sequence
agrkvvvvgggtggataakyikladpsievtliepntdyytcylsneviggdrklesikh
gydglrahgiqvvhdsatgidpdkklvktaggaefgydrcvvapgieliydkiegyseea
aaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvayylkahk
pmskviildssqtfskqsqfskgwerlygfgtenamiewhpgpdsavvkvdggemmveta
fgdefkadvinlippqragkiaqiagltndagwcpvdiktfessihkgihvigdasianp
mpksgysansqgkvaaaavvvllkgeepgtpsylntcysilapaygisvaaiyrpnadgs
aiesvpdsggvtpvdapdwvlerevqyayswynnivhdtfg
Download sequence
Identical sequences 1fcdA 1fcd_A 1fcd_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]