SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1fl2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fl2A
Domain Number 1 Region: 2-303
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.74e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fl2A   PDB: 1fl2
Sequence length 310
Comment (A:)
Sequence
aydvlivgsgpagaaaaiysarkgirtglmgerfggqildtvdienyisvpktegqklag
alkvhvdeydvdvidsqsasklipaavegglhqietasgavlkarsiivatgakwrnmnv
pgedqyrtkgvtycphcdgplfkgkrvavigggnsgveaaidlagivehvtllefapemk
adqvlqdklrslknvdiilnaqttevkgdgskvvgleyrdrvsgdihnielagifvqigl
lpntnwlegavernrmgeiiidakcetnvkgvfaagdcttvpykqiiiatgegakaslsa
fdylirtkta
Download sequence
Identical sequences 1fl2A 1fl2_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]