SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1fljA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fljA
Domain Number 1 Region: 2-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.5e-98
Family Carbonic anhydrase 0.0000000000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fljA   PDB: 1flj   SUPERFAMILY: 1fljA
Sequence length 259
Comment (A:)
Sequence
akewgyashngpehwhelypiakgdnqspielhtkdirhdpslqpwsvsydpgsaktiln
ngktcrvvfddtfdrsmlrggplsgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
hwnpkyntfgealkqpdgiavvgiflkigrekgefqilldaldkiktkgkeapfnhfdps
clfpacrdywtyhgsfttppceecivwlllkepmtvssdqmaklrslfasaeneppvplv
gnwrppqpikgrvvrasfk
Download sequence
Identical sequences d1flja_ 1fljA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]