SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1fr7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1fr7A
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.33e-139
Family Carbonic anhydrase 0.0000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1fr7A   PDB: 1fr7   SUPERFAMILY: 1fr7A
Sequence length 260
Comment (A:)
Sequence
mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
nnghafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhl
vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
vdnwrpaqplknrqikasfk
Download sequence
Identical sequences cath|current|1fr7A00/5-261 cath|current|1fr7B00/5-261 cath|current|1fsnA00/4-261 cath|current|1fsnB00/4-261 cath|current|1fsqA00/3-261 cath|current|1fsqB00/3-261 cath|current|1fsrA00/3-261 cath|current|1fsrB00/3-261 1fr7_A 1fr7_B 1fsn_A 1fsn_B 1fsq_A 1fsq_B 1fsr_A 1fsr_B 1fr7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]