SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1g291 from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g291
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-88
Family ABC transporter ATPase domain-like 0.0000000173
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily MOP-like 3.54e-26
Family ABC-transporter additional domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1g291   PDB: 1g29
Sequence length 372
Comment (1:)
Sequence
magvrlvdvwkvfgevtavremslevkdgefmillgpsgcgktttlrmiagleepsrgqi
yigdklvadpekgifvppkdrdiamvfqsyalyphmtvydniafplklrkvprqeidqrv
revaellgltellnrkprelsggqrqrvalgraivrkpqvflmdeplsnldaklrvrmra
elkklqrqlgvttiyvthdqveamtmgdriavmnrgvlqqvgspdevydkpantfvagfi
gsppmnfldaivtedgfvdfgefrlkllpdqfevlgelgyvgrevifgirpedlydamfa
qvrvpgenlvravveivenlgserivrlrvggvtfvgsfrsesrvregvevdvvfdmkki
hifdkttgkaif
Download sequence
Identical sequences 1g291 1g29_1 1g29_2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]