SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gcaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gcaA
Domain Number 1 Region: 2-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.23e-85
Family L-arabinose binding protein-like 0.000000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gcaA   PDB: 1gca   SUPERFAMILY: 1gcaA
Sequence length 309
Comment (A:)
Sequence
adtrigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgv
kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqg
dliakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldt
amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpe
alalvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdk
dnlseftqk
Download sequence
Identical sequences 1gcaA 1gca_A 1gcg_A 3ga5_A 3ga5_B d1gcaa_ d1gcga_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]