SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gdhA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gdhA
Domain Number 1 Region: 101-289
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.39e-51
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 6.31e-35
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gdhA   PDB: 1gdh
Sequence length 320
Comment (A:)
Sequence
kkkilitwplpeaamararesydviahgddpkitidemietaksvdallitlnekcrkev
idripenikcistysigfdhidldackargikvgnaphgvtvataeiamllllgsarrag
egekmirtrswpgweplelvgekldnktlgiygfgsigqalakraqgfdmdidyfdthra
sssdeasyqatfhdsldsllsvsqffslnapstpetryffnkatikslpqgaivvntarg
dlvdnelvvaaleagrlayagfdvfagepninegyydlpntflfphigsaatqaredmah
qandlidalfggadmsyala
Download sequence
Identical sequences 1gdhA 1gdh_A 1gdh_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]