SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gerA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gerA
Domain Number 1 Region: 338-450
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.02e-68
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000613
Further Details:      
 
Domain Number 2 Region: 1-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.34e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gerA   PDB: 1ger
Sequence length 450
Comment (A:)
Sequence
MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIR
EAIHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDA
KTLEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGYIAV
ELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDG
SLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYA
VGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAR
EQYGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFA
VALKMGATKKDFDNTVAIHPTAAEEFVTMR
Download sequence
Identical sequences A0A1L6ATP2 P06715
1ger_A 1ger_B 1get_A 1get_B gi|387623150|ref|YP_006130778.1| 316385.ECDH10B_3676 316407.gor 511145.b3500 595496.BWG_3189 gi|387623150|ref|YP_006130778.1| 1gerA gi|471335017|ref|YP_007558494.1| NP_417957.1.90541 WP_000160816.1.101033 WP_000160816.1.1113 WP_000160816.1.13618 WP_000160816.1.13949 WP_000160816.1.14529 WP_000160816.1.17087 WP_000160816.1.22113 WP_000160816.1.22830 WP_000160816.1.23511 WP_000160816.1.2428 WP_000160816.1.25713 WP_000160816.1.27879 WP_000160816.1.27923 WP_000160816.1.31211 WP_000160816.1.33424 WP_000160816.1.3401 WP_000160816.1.37261 WP_000160816.1.38105 WP_000160816.1.3811 WP_000160816.1.38636 WP_000160816.1.40192 WP_000160816.1.40548 WP_000160816.1.43489 WP_000160816.1.44162 WP_000160816.1.44365 WP_000160816.1.44849 WP_000160816.1.45933 WP_000160816.1.46802 WP_000160816.1.47048 WP_000160816.1.47634 WP_000160816.1.48194 WP_000160816.1.48974 WP_000160816.1.49531 WP_000160816.1.50006 WP_000160816.1.50078 WP_000160816.1.51552 WP_000160816.1.52020 WP_000160816.1.52558 WP_000160816.1.52895 WP_000160816.1.53012 WP_000160816.1.53020 WP_000160816.1.53377 WP_000160816.1.55825 WP_000160816.1.5614 WP_000160816.1.57414 WP_000160816.1.58401 WP_000160816.1.58951 WP_000160816.1.60717 WP_000160816.1.61949 WP_000160816.1.63167 WP_000160816.1.67853 WP_000160816.1.68711 WP_000160816.1.68797 WP_000160816.1.69473 WP_000160816.1.70794 WP_000160816.1.71024 WP_000160816.1.71975 WP_000160816.1.72157 WP_000160816.1.72397 WP_000160816.1.72910 WP_000160816.1.73859 WP_000160816.1.74309 WP_000160816.1.7461 WP_000160816.1.78321 WP_000160816.1.79004 WP_000160816.1.86461 WP_000160816.1.87389 WP_000160816.1.88434 WP_000160816.1.91340 WP_000160816.1.93755 WP_000160816.1.9457 WP_000160816.1.94949 WP_000160816.1.95595 gi|170083011|ref|YP_001732331.1| gi|238902589|ref|YP_002928385.1| gi|16131372|ref|NP_417957.1| gi|388479741|ref|YP_491935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]