SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gndA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gndA
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.64e-67
Family GDI-like N domain 0.0000000000643
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.51e-16
Family GDI-like N domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gndA   PDB: 1gnd
Sequence length 447
Comment (A:)
Sequence
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE
GPPETMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQNTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETT
DPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGSAFDFENMKRKQNDVFGEADQ
Download sequence
Identical sequences C5IJ94 P21856
ENSBTAP00000016093 ENSBTAP00000016093 1gndA NP_001155343.1.54773 NP_001155343.1.66739 NP_776489.1.59421 NP_776489.1.76553 XP_005910177.1.15283 XP_006043685.1.26621 XP_019811620.1.53367 1gnd_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]