SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gpeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gpeA
Domain Number 1 Region: 4-327,523-584
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.31e-69
Family FAD-linked reductases, N-terminal domain 0.00000000000361
Further Details:      
 
Domain Number 2 Region: 329-524
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.12e-42
Family GMC oxidoreductases 0.00000000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gpeA   PDB: 1gpe
Sequence length 587
Comment (A:)
Sequence
YLPAQQIDVQSSLLSDPSKVAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYE
SNDGAIIEDPNAYGQIFGTTVDQNYLTVPLINNRTNNIKAGKGLGGSTLINGDSWTRPDK
VQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQSGAR
DNGQPWSPIMKALMNTVSALGVPVQQDFLCGHPRGVSMIMNNLDENQVRVDAARAWLLPN
YQRSNLEILTGQMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPL
ILEYSGIGLKSVLDQANVTQLLDLPVGINMQDQTTTTVSSRASSAGAGQGQAVFFANFTE
TFGDYAPQARDLLNTKLDQWAEETVARGGFHNVTALKVQYENYRNWLLDEDVAFAELFMD
TEGKINFDLWDLIPFTRGSVHILSSDPYLWQFANDPKFFLNEFDLLGQAAASKLARDLTS
QGAMKEYFAGETLPGYNLVQNATLSQWSDYVLQNFRPNWHAVSSCSMMSRELGGVVDATA
KVYGTQGLRVIDGSIPPTQVSSHVMTIFYGMALKVADAILDDYAKSA
Download sequence
Identical sequences P81156
1gpe_A 1gpe_B 1gpeA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]