SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gudA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gudA
Domain Number 1 Region: 5-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.48e-78
Family L-arabinose binding protein-like 0.00000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gudA   PDB: 1gud   SUPERFAMILY: 1gudA
Sequence length 288
Comment (A:)
Sequence
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq
Download sequence
Identical sequences d1guba_ d1guda_ d1gudb_ d1rpja_ 1gudA 1gub_A 1gud_A 1gud_B 1rpj_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]