SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1gv4A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gv4A
Domain Number 1 Region: 395-525
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.02e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 43-263
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.26e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000297
Further Details:      
 
Domain Number 3 Region: 216-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.55e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000697
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gv4A   PDB: 1gv4
Sequence length 528
Comment (A:)
Sequence
mhhhhhhssglvprggsgmketaaakferqhmdspdlgtvpqirapshvpflligggtaa
faaarsirardpgarvlivsedpelpymrpplskelwfsddpnvtktlqfrqwngkersi
yfqppsfyvsaqdlpnienggvavltgkkvvhldvrgnmvklndgsqitfekcliatggt
prslsaidragaevksrttlfrkigdfralekisrevksitvigggflgselacalgrks
qasgieviqlfpekgnmgkilpqylsnwtmekvkregvkvmpnaivqsvgvsggrllikl
kdgrkvetdhivtavglepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfy
diklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlgpdvgyeaiglvdsslp
tvgvfakataqdnpksateqsgtgirseseteseaseitippsapavpqvpvegedygkg
vifylrdkvvvgivlwnvfnrmpiarkiikdgeqhedlnevaklfnih
Download sequence
Identical sequences 1gv4A 1gv4_A 1gv4_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]