SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1h4xA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h4xA
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.43e-23
Family Anti-sigma factor antagonist SpoIIaa 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h4xA   PDB: 1h4x   SUPERFAMILY: 1h4xA
Sequence length 117
Comment (A:)
Sequence
mafqlemvtretvvirlfgeldhhaveqirakistaifqgavttiiwnferlsfmdssgv
glvlgrmreleavagrtillnpsptmrkvfqfsglgpwmmdateeeaidrvrgivng
Download sequence
Identical sequences 1h4x_A 1h4x_B 1h4z_A cath|current|1h4zA00/2-114 1h4xA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]