SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1h6vA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h6vA
Domain Number 1 Region: 369-489
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.04e-57
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000312
Further Details:      
 
Domain Number 2 Region: 10-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.48e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h6vA   PDB: 1h6v
Sequence length 499
Comment (A:)
Sequence
mndskdapksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcv
nvgcipkklmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrval
rekkvvyenaygkfigphkimatnnkgkekvysaerfliatgerprylgipgdkeyciss
ddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdqdmankigehm
eehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvllavgrdsctrti
gletvgvkinektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlygg
stvkcdydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnk
cyakvicnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeift
tlsvtkrsggdilqsgccg
Download sequence
Identical sequences 1h6vA 1h6v_A 1h6v_B 1h6v_C 1h6v_D 1h6v_E 1h6v_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]