SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1h9rA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h9rA
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily MOP-like 6.43e-18
Family BiMOP, duplicated molybdate-binding domain 0.0000478
Further Details:      
 
Domain Number 2 Region: 78-137
Classification Level Classification E-value
Superfamily MOP-like 0.00000000000000604
Family BiMOP, duplicated molybdate-binding domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h9rA   PDB: 1h9r
Sequence length 140
Comment (A:)
Sequence
mqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlill
kapwvgitqdeavaqnadnqlpgiishiergaeqcevlmalpdgqtlcatvpvneatslq
qgqnvtayfnadsviiatlc
Download sequence
Identical sequences 1h9rA 1h9r_A 1h9r_B 1h9s_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]