SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1hyuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hyuA
Domain Number 1 Region: 206-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.51e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000294
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.74e-28
Family PDI-like 0.00000422
Further Details:      
 
Domain Number 3 Region: 106-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-24
Family PDI-like 0.00000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hyuA   PDB: 1hyu
Sequence length 521
Comment (A:)
Sequence
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
Download sequence
Identical sequences A0A0D6H5J0 A0A0F7DI23 A0A0H3N9C6 A0A0L5XTI9 A0A0M0Q334 A0A0T7RQR9 A0A0U1ISX5 A0A1C2ZQH3 A0A1X2RT58 A0A1X2UQN8 A0A221YVT1 A0A249V131 A0A265B6T2 A0A267SGW4 A0A271CBF5 A0A2C6FNY6 A0A2C9P2J5 A0A2D1XGG0 A0A2D3AMA5 A0A2G1NLN6 A0A2I6MB08 A0A2I6MNS1 A0A2I6N283 A0A2I6NTV8 A0A2I6P6M4 G5S880 P19480 Q57RW5 S5HTI1 V1WIP4 V7UYX6
gi|378698562|ref|YP_005180519.1| AE006468|CDS_671254-672819 AE017220|CDS_713802-715367 FN424405|CDS_710064-711629 NZ_ACBF01000007|CDS_53513-55078 1hyuA gi|378444103|ref|YP_005231735.1| gi|525816542|ref|YP_008246560.1| gi|482904805|ref|YP_007903365.1| gi|550900042|ref|YP_008669134.1| gi|525856943|ref|YP_008259862.1| gi|449785024|ref|YP_007443150.1| 1hyu_A NP_459601.1.58477 WP_000887644.1.100007 WP_000887644.1.100010 WP_000887644.1.100017 WP_000887644.1.100031 WP_000887644.1.100129 WP_000887644.1.10013 WP_000887644.1.100137 WP_000887644.1.100165 WP_000887644.1.1002 WP_000887644.1.100234 WP_000887644.1.100258 WP_000887644.1.100266 WP_000887644.1.100288 WP_000887644.1.100376 WP_000887644.1.100413 WP_000887644.1.100424 WP_000887644.1.100436 WP_000887644.1.100438 WP_000887644.1.100484 WP_000887644.1.100488 WP_000887644.1.100521 WP_000887644.1.100584 WP_000887644.1.100589 WP_000887644.1.100597 WP_000887644.1.100707 WP_000887644.1.100714 WP_000887644.1.100721 WP_000887644.1.100730 WP_000887644.1.10074 WP_000887644.1.100750 WP_000887644.1.10076 WP_000887644.1.100773 WP_000887644.1.100781 WP_000887644.1.100790 WP_000887644.1.100793 WP_000887644.1.100865 WP_000887644.1.100869 WP_000887644.1.100871 WP_000887644.1.100882 WP_000887644.1.100886 WP_000887644.1.100932 WP_000887644.1.100944 WP_000887644.1.101007 WP_000887644.1.101020 WP_000887644.1.101042 WP_000887644.1.101074 WP_000887644.1.101078 WP_000887644.1.101091 WP_000887644.1.101094 WP_000887644.1.101123 WP_000887644.1.101126 WP_000887644.1.101147 WP_000887644.1.101180 WP_000887644.1.101199 WP_000887644.1.101223 WP_000887644.1.101259 WP_000887644.1.101284 WP_000887644.1.101291 WP_000887644.1.1013 WP_000887644.1.101320 WP_000887644.1.101353 WP_000887644.1.101386 WP_000887644.1.101404 WP_000887644.1.101420 WP_000887644.1.101425 WP_000887644.1.101454 WP_000887644.1.101473 WP_000887644.1.101519 WP_000887644.1.101589 WP_000887644.1.101612 WP_000887644.1.101636 WP_000887644.1.101639 WP_000887644.1.10164 WP_000887644.1.101707 WP_000887644.1.101724 WP_000887644.1.101734 WP_000887644.1.101759 WP_000887644.1.10177 WP_000887644.1.101776 WP_000887644.1.101815 WP_000887644.1.101839 WP_000887644.1.101841 WP_000887644.1.101868 WP_000887644.1.101878 WP_000887644.1.10191 WP_000887644.1.101927 WP_000887644.1.101949 WP_000887644.1.101953 WP_000887644.1.101975 WP_000887644.1.102009 WP_000887644.1.102103 WP_000887644.1.10220 WP_000887644.1.10231 WP_000887644.1.10237 WP_000887644.1.10266 WP_000887644.1.10293 WP_000887644.1.10310 WP_000887644.1.10394 WP_000887644.1.10429 WP_000887644.1.10439 WP_000887644.1.10463 WP_000887644.1.10465 WP_000887644.1.10507 WP_000887644.1.10521 WP_000887644.1.10562 WP_000887644.1.10566 WP_000887644.1.106 WP_000887644.1.10678 WP_000887644.1.10711 WP_000887644.1.10720 WP_000887644.1.10753 WP_000887644.1.10797 WP_000887644.1.10992 WP_000887644.1.11000 WP_000887644.1.11024 WP_000887644.1.11031 WP_000887644.1.11098 WP_000887644.1.1110 WP_000887644.1.11156 WP_000887644.1.11168 WP_000887644.1.11190 WP_000887644.1.11213 WP_000887644.1.11295 WP_000887644.1.11304 WP_000887644.1.11362 WP_000887644.1.11369 WP_000887644.1.1137 WP_000887644.1.11405 WP_000887644.1.11455 WP_000887644.1.11458 WP_000887644.1.11479 WP_000887644.1.11518 WP_000887644.1.11532 WP_000887644.1.11544 WP_000887644.1.11565 WP_000887644.1.11588 WP_000887644.1.11603 WP_000887644.1.11621 WP_000887644.1.11677 WP_000887644.1.11681 WP_000887644.1.11687 WP_000887644.1.11735 WP_000887644.1.11763 WP_000887644.1.11772 WP_000887644.1.11834 WP_000887644.1.11897 WP_000887644.1.11936 WP_000887644.1.11938 WP_000887644.1.11964 WP_000887644.1.12007 WP_000887644.1.12017 WP_000887644.1.12025 WP_000887644.1.12047 WP_000887644.1.12059 WP_000887644.1.12063 WP_000887644.1.12114 WP_000887644.1.12144 WP_000887644.1.12159 WP_000887644.1.12160 WP_000887644.1.12280 WP_000887644.1.12282 WP_000887644.1.1239 WP_000887644.1.12396 WP_000887644.1.12456 WP_000887644.1.1246 WP_000887644.1.12472 WP_000887644.1.12484 WP_000887644.1.12546 WP_000887644.1.1264 WP_000887644.1.12650 WP_000887644.1.12701 WP_000887644.1.12728 WP_000887644.1.12877 WP_000887644.1.12879 WP_000887644.1.12936 WP_000887644.1.12995 WP_000887644.1.13027 WP_000887644.1.13101 WP_000887644.1.13106 WP_000887644.1.13130 WP_000887644.1.13207 WP_000887644.1.13334 WP_000887644.1.13414 WP_000887644.1.13446 WP_000887644.1.13488 WP_000887644.1.13509 WP_000887644.1.13528 WP_000887644.1.13669 WP_000887644.1.13677 WP_000887644.1.13741 WP_000887644.1.13799 WP_000887644.1.13819 WP_000887644.1.13827 WP_000887644.1.13829 WP_000887644.1.13857 WP_000887644.1.1387 WP_000887644.1.13908 WP_000887644.1.13932 WP_000887644.1.13968 WP_000887644.1.14001 WP_000887644.1.14041 WP_000887644.1.14050 WP_000887644.1.14056 WP_000887644.1.14111 WP_000887644.1.14151 WP_000887644.1.14212 WP_000887644.1.14239 WP_000887644.1.14296 WP_000887644.1.14320 WP_000887644.1.14369 WP_000887644.1.14379 WP_000887644.1.14406 WP_000887644.1.14410 WP_000887644.1.14436 WP_000887644.1.14446 WP_000887644.1.14458 WP_000887644.1.14466 WP_000887644.1.14495 WP_000887644.1.14519 WP_000887644.1.14524 WP_000887644.1.14528 WP_000887644.1.14554 WP_000887644.1.14618 WP_000887644.1.14688 WP_000887644.1.14706 WP_000887644.1.14725 WP_000887644.1.14808 WP_000887644.1.14852 WP_000887644.1.14876 WP_000887644.1.1489 WP_000887644.1.14927 WP_000887644.1.14932 WP_000887644.1.14936 WP_000887644.1.14964 WP_000887644.1.15046 WP_000887644.1.15054 WP_000887644.1.15055 WP_000887644.1.15100 WP_000887644.1.15124 WP_000887644.1.15214 WP_000887644.1.15223 WP_000887644.1.15226 WP_000887644.1.15316 WP_000887644.1.15353 WP_000887644.1.15369 WP_000887644.1.1540 WP_000887644.1.15468 WP_000887644.1.15479 WP_000887644.1.15508 WP_000887644.1.1551 WP_000887644.1.15586 WP_000887644.1.15612 WP_000887644.1.15627 WP_000887644.1.15637 WP_000887644.1.15644 WP_000887644.1.15784 WP_000887644.1.158 WP_000887644.1.15830 WP_000887644.1.15862 WP_000887644.1.15881 WP_000887644.1.15910 WP_000887644.1.1592 WP_000887644.1.15978 WP_000887644.1.15986 WP_000887644.1.15995 WP_000887644.1.16000 WP_000887644.1.16004 WP_000887644.1.1601 WP_000887644.1.16028 WP_000887644.1.16032 WP_000887644.1.16047 WP_000887644.1.16052 WP_000887644.1.16062 WP_000887644.1.16063 WP_000887644.1.16103 WP_000887644.1.1611 WP_000887644.1.16125 WP_000887644.1.16158 WP_000887644.1.16166 WP_000887644.1.16233 WP_000887644.1.16244 WP_000887644.1.16273 WP_000887644.1.16284 WP_000887644.1.16328 WP_000887644.1.1635 WP_000887644.1.16361 WP_000887644.1.16468 WP_000887644.1.16525 WP_000887644.1.16551 WP_000887644.1.16565 WP_000887644.1.16581 WP_000887644.1.16614 WP_000887644.1.16650 WP_000887644.1.16656 WP_000887644.1.1668 WP_000887644.1.16686 WP_000887644.1.16691 WP_000887644.1.167 WP_000887644.1.16732 WP_000887644.1.16735 WP_000887644.1.16736 WP_000887644.1.16786 WP_000887644.1.16804 WP_000887644.1.16817 WP_000887644.1.16826 WP_000887644.1.16846 WP_000887644.1.16855 WP_000887644.1.16858 WP_000887644.1.16873 WP_000887644.1.16896 WP_000887644.1.16903 WP_000887644.1.16916 WP_000887644.1.1700 WP_000887644.1.17031 WP_000887644.1.17093 WP_000887644.1.17098 WP_000887644.1.17188 WP_000887644.1.17270 WP_000887644.1.17307 WP_000887644.1.1737 WP_000887644.1.174 WP_000887644.1.17439 WP_000887644.1.17480 WP_000887644.1.1749 WP_000887644.1.17504 WP_000887644.1.17546 WP_000887644.1.17560 WP_000887644.1.1757 WP_000887644.1.17629 WP_000887644.1.17702 WP_000887644.1.17705 WP_000887644.1.17747 WP_000887644.1.17758 WP_000887644.1.17865 WP_000887644.1.17891 WP_000887644.1.17901 WP_000887644.1.17919 WP_000887644.1.17949 WP_000887644.1.1798 WP_000887644.1.18019 WP_000887644.1.1807 WP_000887644.1.18089 WP_000887644.1.18103 WP_000887644.1.18111 WP_000887644.1.18122 WP_000887644.1.1814 WP_000887644.1.18163 WP_000887644.1.1818 WP_000887644.1.18192 WP_000887644.1.1825 WP_000887644.1.18254 WP_000887644.1.18265 WP_000887644.1.18267 WP_000887644.1.18277 WP_000887644.1.18282 WP_000887644.1.18365 WP_000887644.1.18426 WP_000887644.1.18445 WP_000887644.1.18468 WP_000887644.1.18485 WP_000887644.1.18607 WP_000887644.1.18705 WP_000887644.1.18715 WP_000887644.1.18776 WP_000887644.1.18822 WP_000887644.1.18881 WP_000887644.1.18919 WP_000887644.1.18940 WP_000887644.1.18949 WP_000887644.1.19030 WP_000887644.1.19038 WP_000887644.1.19053 WP_000887644.1.19055 WP_000887644.1.19174 WP_000887644.1.19240 WP_000887644.1.19273 WP_000887644.1.19291 WP_000887644.1.19340 WP_000887644.1.19357 WP_000887644.1.1939 WP_000887644.1.19405 WP_000887644.1.19458 WP_000887644.1.19460 WP_000887644.1.19461 WP_000887644.1.19469 WP_000887644.1.1954 WP_000887644.1.19588 WP_000887644.1.19614 WP_000887644.1.19616 WP_000887644.1.19642 WP_000887644.1.1968 WP_000887644.1.19683 WP_000887644.1.19702 WP_000887644.1.19706 WP_000887644.1.19723 WP_000887644.1.19724 WP_000887644.1.19740 WP_000887644.1.19749 WP_000887644.1.19784 WP_000887644.1.19793 WP_000887644.1.19802 WP_000887644.1.19809 WP_000887644.1.19823 WP_000887644.1.19851 WP_000887644.1.19867 WP_000887644.1.19884 WP_000887644.1.1990 WP_000887644.1.19975 WP_000887644.1.1998 WP_000887644.1.19987 WP_000887644.1.20 WP_000887644.1.20023 WP_000887644.1.20081 WP_000887644.1.20089 WP_000887644.1.2010 WP_000887644.1.20119 WP_000887644.1.20212 WP_000887644.1.2026 WP_000887644.1.20266 WP_000887644.1.20271 WP_000887644.1.20330 WP_000887644.1.20349 WP_000887644.1.20362 WP_000887644.1.20364 WP_000887644.1.20415 WP_000887644.1.20418 WP_000887644.1.20443 WP_000887644.1.20446 WP_000887644.1.20488 WP_000887644.1.20525 WP_000887644.1.2054 WP_000887644.1.20553 WP_000887644.1.20573 WP_000887644.1.20614 WP_000887644.1.20626 WP_000887644.1.20631 WP_000887644.1.20646 WP_000887644.1.20700 WP_000887644.1.20760 WP_000887644.1.20767 WP_000887644.1.20787 WP_000887644.1.20789 WP_000887644.1.20795 WP_000887644.1.20810 WP_000887644.1.20839 WP_000887644.1.20862 WP_000887644.1.20886 WP_000887644.1.20900 WP_000887644.1.20908 WP_000887644.1.2091 WP_000887644.1.2101 WP_000887644.1.21049 WP_000887644.1.21075 WP_000887644.1.21086 WP_000887644.1.21089 WP_000887644.1.21136 WP_000887644.1.21146 WP_000887644.1.21165 WP_000887644.1.21245 WP_000887644.1.21246 WP_000887644.1.21260 WP_000887644.1.21269 WP_000887644.1.21286 WP_000887644.1.2130 WP_000887644.1.21309 WP_000887644.1.21326 WP_000887644.1.21351 WP_000887644.1.21362 WP_000887644.1.21399 WP_000887644.1.21400 WP_000887644.1.21404 WP_000887644.1.21443 WP_000887644.1.21453 WP_000887644.1.2146 WP_000887644.1.21473 WP_000887644.1.21497 WP_000887644.1.21499 WP_000887644.1.21548 WP_000887644.1.21603 WP_000887644.1.21616 WP_000887644.1.21692 WP_000887644.1.21728 WP_000887644.1.21730 WP_000887644.1.21750 WP_000887644.1.21751 WP_000887644.1.21757 WP_000887644.1.21845 WP_000887644.1.21877 WP_000887644.1.22019 WP_000887644.1.22024 WP_000887644.1.22030 WP_000887644.1.2205 WP_000887644.1.22062 WP_000887644.1.22067 WP_000887644.1.22069 WP_000887644.1.22117 WP_000887644.1.22169 WP_000887644.1.22205 WP_000887644.1.2221 WP_000887644.1.22235 WP_000887644.1.22240 WP_000887644.1.22270 WP_000887644.1.22315 WP_000887644.1.22323 WP_000887644.1.2235 WP_000887644.1.22379 WP_000887644.1.22388 WP_000887644.1.22427 WP_000887644.1.22453 WP_000887644.1.2246 WP_000887644.1.22485 WP_000887644.1.22537 WP_000887644.1.22565 WP_000887644.1.22582 WP_000887644.1.22590 WP_000887644.1.22604 WP_000887644.1.22620 WP_000887644.1.22623 WP_000887644.1.22676 WP_000887644.1.22692 WP_000887644.1.22758 WP_000887644.1.2283 WP_000887644.1.22845 WP_000887644.1.22864 WP_000887644.1.22870 WP_000887644.1.22966 WP_000887644.1.22979 WP_000887644.1.23010 WP_000887644.1.23053 WP_000887644.1.23080 WP_000887644.1.23102 WP_000887644.1.23114 WP_000887644.1.2314 WP_000887644.1.23148 WP_000887644.1.23175 WP_000887644.1.23192 WP_000887644.1.23201 WP_000887644.1.23246 WP_000887644.1.23258 WP_000887644.1.23259 WP_000887644.1.23274 WP_000887644.1.23309 WP_000887644.1.23311 WP_000887644.1.23343 WP_000887644.1.23379 WP_000887644.1.2342 WP_000887644.1.23444 WP_000887644.1.23460 WP_000887644.1.23472 WP_000887644.1.23482 WP_000887644.1.23485 WP_000887644.1.235 WP_000887644.1.23500 WP_000887644.1.23503 WP_000887644.1.23509 WP_000887644.1.23529 WP_000887644.1.23587 WP_000887644.1.23629 WP_000887644.1.23634 WP_000887644.1.2364 WP_000887644.1.23646 WP_000887644.1.23670 WP_000887644.1.23675 WP_000887644.1.237 WP_000887644.1.23707 WP_000887644.1.23720 WP_000887644.1.23755 WP_000887644.1.2376 WP_000887644.1.2380 WP_000887644.1.23819 WP_000887644.1.23932 WP_000887644.1.23959 WP_000887644.1.24017 WP_000887644.1.24082 WP_000887644.1.24158 WP_000887644.1.24163 WP_000887644.1.24206 WP_000887644.1.24308 WP_000887644.1.24376 WP_000887644.1.24392 WP_000887644.1.24412 WP_000887644.1.24419 WP_000887644.1.24433 WP_000887644.1.24444 WP_000887644.1.24450 WP_000887644.1.24521 WP_000887644.1.24555 WP_000887644.1.24567 WP_000887644.1.24578 WP_000887644.1.2467 WP_000887644.1.24686 WP_000887644.1.24696 WP_000887644.1.24723 WP_000887644.1.24737 WP_000887644.1.24803 WP_000887644.1.24837 WP_000887644.1.24839 WP_000887644.1.24873 WP_000887644.1.24995 WP_000887644.1.25008 WP_000887644.1.25015 WP_000887644.1.25036 WP_000887644.1.25064 WP_000887644.1.25072 WP_000887644.1.25119 WP_000887644.1.25205 WP_000887644.1.25206 WP_000887644.1.2525 WP_000887644.1.25297 WP_000887644.1.25397 WP_000887644.1.25405 WP_000887644.1.25421 WP_000887644.1.25454 WP_000887644.1.25493 WP_000887644.1.25514 WP_000887644.1.25546 WP_000887644.1.25564 WP_000887644.1.25668 WP_000887644.1.2568 WP_000887644.1.25690 WP_000887644.1.2570 WP_000887644.1.25703 WP_000887644.1.25708 WP_000887644.1.25709 WP_000887644.1.25722 WP_000887644.1.25740 WP_000887644.1.25793 WP_000887644.1.25809 WP_000887644.1.25814 WP_000887644.1.25825 WP_000887644.1.25928 WP_000887644.1.25932 WP_000887644.1.25988 WP_000887644.1.26034 WP_000887644.1.26093 WP_000887644.1.26123 WP_000887644.1.26129 WP_000887644.1.26213 WP_000887644.1.26224 WP_000887644.1.26282 WP_000887644.1.26311 WP_000887644.1.26319 WP_000887644.1.26384 WP_000887644.1.26429 WP_000887644.1.26440 WP_000887644.1.26493 WP_000887644.1.26512 WP_000887644.1.26532 WP_000887644.1.26551 WP_000887644.1.26563 WP_000887644.1.26567 WP_000887644.1.26576 WP_000887644.1.26587 WP_000887644.1.26646 WP_000887644.1.2667 WP_000887644.1.26709 WP_000887644.1.26741 WP_000887644.1.26758 WP_000887644.1.26787 WP_000887644.1.26833 WP_000887644.1.26856 WP_000887644.1.26882 WP_000887644.1.26883 WP_000887644.1.26892 WP_000887644.1.26919 WP_000887644.1.26924 WP_000887644.1.27010 WP_000887644.1.27055 WP_000887644.1.27072 WP_000887644.1.27084 WP_000887644.1.27122 WP_000887644.1.27173 WP_000887644.1.27206 WP_000887644.1.27223 WP_000887644.1.2723 WP_000887644.1.27342 WP_000887644.1.27423 WP_000887644.1.27513 WP_000887644.1.27522 WP_000887644.1.27535 WP_000887644.1.27544 WP_000887644.1.27561 WP_000887644.1.27616 WP_000887644.1.2763 WP_000887644.1.27655 WP_000887644.1.27665 WP_000887644.1.27679 WP_000887644.1.27707 WP_000887644.1.27713 WP_000887644.1.27761 WP_000887644.1.27776 WP_000887644.1.27815 WP_000887644.1.27857 WP_000887644.1.27969 WP_000887644.1.27977 WP_000887644.1.28002 WP_000887644.1.28032 WP_000887644.1.2806 WP_000887644.1.28073 WP_000887644.1.28094 WP_000887644.1.28116 WP_000887644.1.28126 WP_000887644.1.28170 WP_000887644.1.28174 WP_000887644.1.28225 WP_000887644.1.28235 WP_000887644.1.2825 WP_000887644.1.28267 WP_000887644.1.2829 WP_000887644.1.28302 WP_000887644.1.2835 WP_000887644.1.28370 WP_000887644.1.28393 WP_000887644.1.28538 WP_000887644.1.28575 WP_000887644.1.28625 WP_000887644.1.28655 WP_000887644.1.28673 WP_000887644.1.28694 WP_000887644.1.287 WP_000887644.1.28775 WP_000887644.1.28776 WP_000887644.1.2879 WP_000887644.1.28830 WP_000887644.1.2890 WP_000887644.1.28902 WP_000887644.1.28938 WP_000887644.1.28946 WP_000887644.1.28948 WP_000887644.1.28963 WP_000887644.1.28977 WP_000887644.1.29006 WP_000887644.1.29010 WP_000887644.1.29099 WP_000887644.1.2910 WP_000887644.1.29113 WP_000887644.1.29130 WP_000887644.1.29190 WP_000887644.1.29255 WP_000887644.1.29265 WP_000887644.1.29274 WP_000887644.1.29349 WP_000887644.1.29509 WP_000887644.1.29530 WP_000887644.1.29588 WP_000887644.1.29593 WP_000887644.1.29601 WP_000887644.1.29606 WP_000887644.1.29615 WP_000887644.1.29619 WP_000887644.1.29682 WP_000887644.1.29704 WP_000887644.1.29732 WP_000887644.1.29768 WP_000887644.1.29774 WP_000887644.1.29775 WP_000887644.1.29827 WP_000887644.1.29898 WP_000887644.1.29923 WP_000887644.1.29969 WP_000887644.1.29990 WP_000887644.1.30006 WP_000887644.1.30022 WP_000887644.1.30027 WP_000887644.1.30086 WP_000887644.1.30093 WP_000887644.1.3017 WP_000887644.1.30170 WP_000887644.1.30179 WP_000887644.1.30180 WP_000887644.1.30202 WP_000887644.1.30225 WP_000887644.1.30238 WP_000887644.1.30246 WP_000887644.1.30331 WP_000887644.1.30356 WP_000887644.1.30425 WP_000887644.1.30437 WP_000887644.1.30469 WP_000887644.1.30505 WP_000887644.1.30507 WP_000887644.1.30535 WP_000887644.1.30547 WP_000887644.1.30602 WP_000887644.1.30635 WP_000887644.1.3066 WP_000887644.1.3067 WP_000887644.1.3068 WP_000887644.1.30696 WP_000887644.1.3076 WP_000887644.1.30794 WP_000887644.1.30802 WP_000887644.1.30803 WP_000887644.1.30823 WP_000887644.1.30833 WP_000887644.1.30835 WP_000887644.1.30934 WP_000887644.1.31 WP_000887644.1.31011 WP_000887644.1.31042 WP_000887644.1.31086 WP_000887644.1.31092 WP_000887644.1.31111 WP_000887644.1.31122 WP_000887644.1.3113 WP_000887644.1.3114 WP_000887644.1.31155 WP_000887644.1.31156 WP_000887644.1.31171 WP_000887644.1.31185 WP_000887644.1.3119 WP_000887644.1.31190 WP_000887644.1.31195 WP_000887644.1.31196 WP_000887644.1.31198 WP_000887644.1.31214 WP_000887644.1.31219 WP_000887644.1.31222 WP_000887644.1.3124 WP_000887644.1.31251 WP_000887644.1.3127 WP_000887644.1.31281 WP_000887644.1.31362 WP_000887644.1.31451 WP_000887644.1.31504 WP_000887644.1.31515 WP_000887644.1.31578 WP_000887644.1.31658 WP_000887644.1.31665 WP_000887644.1.3170 WP_000887644.1.31782 WP_000887644.1.31845 WP_000887644.1.3185 WP_000887644.1.31854 WP_000887644.1.31927 WP_000887644.1.31940 WP_000887644.1.31952 WP_000887644.1.31967 WP_000887644.1.31972 WP_000887644.1.31983 WP_000887644.1.32056 WP_000887644.1.32170 WP_000887644.1.32192 WP_000887644.1.32204 WP_000887644.1.32206 WP_000887644.1.32260 WP_000887644.1.32277 WP_000887644.1.32357 WP_000887644.1.32368 WP_000887644.1.32408 WP_000887644.1.32423 WP_000887644.1.32424 WP_000887644.1.32438 WP_000887644.1.32491 WP_000887644.1.32493 WP_000887644.1.32515 WP_000887644.1.32527 WP_000887644.1.32545 WP_000887644.1.32643 WP_000887644.1.32660 WP_000887644.1.32702 WP_000887644.1.32714 WP_000887644.1.32750 WP_000887644.1.3278 WP_000887644.1.32786 WP_000887644.1.32804 WP_000887644.1.32860 WP_000887644.1.32900 WP_000887644.1.32902 WP_000887644.1.32907 WP_000887644.1.32930 WP_000887644.1.32961 WP_000887644.1.33010 WP_000887644.1.33030 WP_000887644.1.3304 WP_000887644.1.3310 WP_000887644.1.33106 WP_000887644.1.33127 WP_000887644.1.33143 WP_000887644.1.33144 WP_000887644.1.33160 WP_000887644.1.33248 WP_000887644.1.33261 WP_000887644.1.333 WP_000887644.1.33392 WP_000887644.1.33492 WP_000887644.1.33499 WP_000887644.1.33553 WP_000887644.1.33580 WP_000887644.1.33592 WP_000887644.1.33629 WP_000887644.1.33659 WP_000887644.1.33693 WP_000887644.1.33865 WP_000887644.1.33894 WP_000887644.1.3394 WP_000887644.1.3395 WP_000887644.1.33986 WP_000887644.1.34022 WP_000887644.1.34043 WP_000887644.1.34075 WP_000887644.1.34084 WP_000887644.1.34107 WP_000887644.1.34126 WP_000887644.1.34184 WP_000887644.1.34257 WP_000887644.1.34259 WP_000887644.1.34279 WP_000887644.1.34330 WP_000887644.1.34417 WP_000887644.1.3445 WP_000887644.1.34453 WP_000887644.1.34458 WP_000887644.1.34610 WP_000887644.1.34684 WP_000887644.1.34703 WP_000887644.1.34704 WP_000887644.1.34707 WP_000887644.1.3476 WP_000887644.1.34801 WP_000887644.1.34817 WP_000887644.1.34854 WP_000887644.1.34856 WP_000887644.1.34881 WP_000887644.1.34972 WP_000887644.1.34975 WP_000887644.1.34977 WP_000887644.1.35035 WP_000887644.1.35045 WP_000887644.1.35075 WP_000887644.1.35129 WP_000887644.1.35184 WP_000887644.1.35193 WP_000887644.1.35332 WP_000887644.1.35404 WP_000887644.1.35408 WP_000887644.1.3541 WP_000887644.1.35425 WP_000887644.1.35429 WP_000887644.1.35446 WP_000887644.1.35460 WP_000887644.1.35463 WP_000887644.1.35494 WP_000887644.1.35503 WP_000887644.1.35509 WP_000887644.1.3556 WP_000887644.1.35590 WP_000887644.1.35619 WP_000887644.1.3566 WP_000887644.1.3572 WP_000887644.1.35777 WP_000887644.1.35835 WP_000887644.1.35868 WP_000887644.1.35892 WP_000887644.1.35940 WP_000887644.1.35993 WP_000887644.1.36003 WP_000887644.1.3601 WP_000887644.1.36011 WP_000887644.1.36017 WP_000887644.1.3610 WP_000887644.1.36229 WP_000887644.1.36232 WP_000887644.1.36236 WP_000887644.1.36512 WP_000887644.1.36542 WP_000887644.1.36547 WP_000887644.1.36609 WP_000887644.1.36652 WP_000887644.1.36690 WP_000887644.1.3670 WP_000887644.1.36705 WP_000887644.1.36751 WP_000887644.1.36765 WP_000887644.1.36839 WP_000887644.1.3688 WP_000887644.1.36885 WP_000887644.1.36918 WP_000887644.1.36931 WP_000887644.1.36948 WP_000887644.1.36949 WP_000887644.1.36978 WP_000887644.1.37021 WP_000887644.1.37028 WP_000887644.1.37063 WP_000887644.1.37073 WP_000887644.1.37100 WP_000887644.1.37111 WP_000887644.1.37112 WP_000887644.1.37147 WP_000887644.1.37158 WP_000887644.1.37190 WP_000887644.1.37256 WP_000887644.1.3726 WP_000887644.1.3728 WP_000887644.1.37293 WP_000887644.1.37320 WP_000887644.1.3734 WP_000887644.1.37370 WP_000887644.1.37376 WP_000887644.1.3744 WP_000887644.1.37478 WP_000887644.1.37498 WP_000887644.1.37504 WP_000887644.1.3751 WP_000887644.1.37521 WP_000887644.1.3756 WP_000887644.1.37610 WP_000887644.1.37618 WP_000887644.1.37666 WP_000887644.1.37687 WP_000887644.1.37719 WP_000887644.1.37808 WP_000887644.1.37848 WP_000887644.1.37965 WP_000887644.1.37968 WP_000887644.1.37978 WP_000887644.1.38026 WP_000887644.1.38055 WP_000887644.1.38113 WP_000887644.1.38125 WP_000887644.1.38145 WP_000887644.1.3828 WP_000887644.1.383 WP_000887644.1.38322 WP_000887644.1.38341 WP_000887644.1.38349 WP_000887644.1.38408 WP_000887644.1.3848 WP_000887644.1.38512 WP_000887644.1.38569 WP_000887644.1.38609 WP_000887644.1.38613 WP_000887644.1.38622 WP_000887644.1.38673 WP_000887644.1.3869 WP_000887644.1.38693 WP_000887644.1.38740 WP_000887644.1.38773 WP_000887644.1.38781 WP_000887644.1.38797 WP_000887644.1.38830 WP_000887644.1.38882 WP_000887644.1.38895 WP_000887644.1.38898 WP_000887644.1.3891 WP_000887644.1.38913 WP_000887644.1.38942 WP_000887644.1.38995 WP_000887644.1.39003 WP_000887644.1.39059 WP_000887644.1.39075 WP_000887644.1.39128 WP_000887644.1.39136 WP_000887644.1.39146 WP_000887644.1.39183 WP_000887644.1.39197 WP_000887644.1.39229 WP_000887644.1.39265 WP_000887644.1.39275 WP_000887644.1.39311 WP_000887644.1.39405 WP_000887644.1.39414 WP_000887644.1.39420 WP_000887644.1.39449 WP_000887644.1.39466 WP_000887644.1.39497 WP_000887644.1.39503 WP_000887644.1.39512 WP_000887644.1.39556 WP_000887644.1.39576 WP_000887644.1.39584 WP_000887644.1.39609 WP_000887644.1.39614 WP_000887644.1.39629 WP_000887644.1.39632 WP_000887644.1.39722 WP_000887644.1.39723 WP_000887644.1.39724 WP_000887644.1.39763 WP_000887644.1.39808 WP_000887644.1.39862 WP_000887644.1.39921 WP_000887644.1.39923 WP_000887644.1.40008 WP_000887644.1.40017 WP_000887644.1.40072 WP_000887644.1.40073 WP_000887644.1.4011 WP_000887644.1.40155 WP_000887644.1.40158 WP_000887644.1.40170 WP_000887644.1.40171 WP_000887644.1.40205 WP_000887644.1.40208 WP_000887644.1.40224 WP_000887644.1.40229 WP_000887644.1.40240 WP_000887644.1.40254 WP_000887644.1.40257 WP_000887644.1.40258 WP_000887644.1.40284 WP_000887644.1.40292 WP_000887644.1.40305 WP_000887644.1.40311 WP_000887644.1.40341 WP_000887644.1.40374 WP_000887644.1.40380 WP_000887644.1.40395 WP_000887644.1.40465 WP_000887644.1.40492 WP_000887644.1.40508 WP_000887644.1.40583 WP_000887644.1.40648 WP_000887644.1.40693 WP_000887644.1.40710 WP_000887644.1.40722 WP_000887644.1.4075 WP_000887644.1.40788 WP_000887644.1.4087 WP_000887644.1.40877 WP_000887644.1.40910 WP_000887644.1.40935 WP_000887644.1.40996 WP_000887644.1.41017 WP_000887644.1.41018 WP_000887644.1.41048 WP_000887644.1.41050 WP_000887644.1.41086 WP_000887644.1.4109 WP_000887644.1.41091 WP_000887644.1.41225 WP_000887644.1.41226 WP_000887644.1.41265 WP_000887644.1.41279 WP_000887644.1.41308 WP_000887644.1.41310 WP_000887644.1.41345 WP_000887644.1.41375 WP_000887644.1.4141 WP_000887644.1.41434 WP_000887644.1.41438 WP_000887644.1.41440 WP_000887644.1.41516 WP_000887644.1.41554 WP_000887644.1.41572 WP_000887644.1.41591 WP_000887644.1.41593 WP_000887644.1.41628 WP_000887644.1.41662 WP_000887644.1.41708 WP_000887644.1.41724 WP_000887644.1.41761 WP_000887644.1.41789 WP_000887644.1.4184 WP_000887644.1.41859 WP_000887644.1.41862 WP_000887644.1.41877 WP_000887644.1.41882 WP_000887644.1.41904 WP_000887644.1.41931 WP_000887644.1.41938 WP_000887644.1.41979 WP_000887644.1.41985 WP_000887644.1.41994 WP_000887644.1.41998 WP_000887644.1.42009 WP_000887644.1.42104 WP_000887644.1.42109 WP_000887644.1.42156 WP_000887644.1.4222 WP_000887644.1.42238 WP_000887644.1.42243 WP_000887644.1.42244 WP_000887644.1.42248 WP_000887644.1.42276 WP_000887644.1.42320 WP_000887644.1.42328 WP_000887644.1.42342 WP_000887644.1.42356 WP_000887644.1.4239 WP_000887644.1.42422 WP_000887644.1.42433 WP_000887644.1.42444 WP_000887644.1.42453 WP_000887644.1.42489 WP_000887644.1.42491 WP_000887644.1.4257 WP_000887644.1.42605 WP_000887644.1.42655 WP_000887644.1.42676 WP_000887644.1.4276 WP_000887644.1.42767 WP_000887644.1.42794 WP_000887644.1.42864 WP_000887644.1.4288 WP_000887644.1.42923 WP_000887644.1.42978 WP_000887644.1.43018 WP_000887644.1.43041 WP_000887644.1.43070 WP_000887644.1.43077 WP_000887644.1.43089 WP_000887644.1.43160 WP_000887644.1.43244 WP_000887644.1.43272 WP_000887644.1.43276 WP_000887644.1.43299 WP_000887644.1.4332 WP_000887644.1.43334 WP_000887644.1.43339 WP_000887644.1.43351 WP_000887644.1.43371 WP_000887644.1.43437 WP_000887644.1.43441 WP_000887644.1.43476 WP_000887644.1.43520 WP_000887644.1.43522 WP_000887644.1.43528 WP_000887644.1.43535 WP_000887644.1.43613 WP_000887644.1.43654 WP_000887644.1.43668 WP_000887644.1.43778 WP_000887644.1.43828 WP_000887644.1.43839 WP_000887644.1.43864 WP_000887644.1.43873 WP_000887644.1.43886 WP_000887644.1.43951 WP_000887644.1.43954 WP_000887644.1.44005 WP_000887644.1.4404 WP_000887644.1.44043 WP_000887644.1.44063 WP_000887644.1.44099 WP_000887644.1.44113 WP_000887644.1.44121 WP_000887644.1.44132 WP_000887644.1.44191 WP_000887644.1.4423 WP_000887644.1.44250 WP_000887644.1.44291 WP_000887644.1.44300 WP_000887644.1.44310 WP_000887644.1.44339 WP_000887644.1.44359 WP_000887644.1.44380 WP_000887644.1.44397 WP_000887644.1.4440 WP_000887644.1.44433 WP_000887644.1.44443 WP_000887644.1.44453 WP_000887644.1.44479 WP_000887644.1.44578 WP_000887644.1.44593 WP_000887644.1.44607 WP_000887644.1.44633 WP_000887644.1.44636 WP_000887644.1.44640 WP_000887644.1.4467 WP_000887644.1.44678 WP_000887644.1.44702 WP_000887644.1.44747 WP_000887644.1.44791 WP_000887644.1.44833 WP_000887644.1.4485 WP_000887644.1.44877 WP_000887644.1.44887 WP_000887644.1.449 WP_000887644.1.44927 WP_000887644.1.44933 WP_000887644.1.44943 WP_000887644.1.44950 WP_000887644.1.44971 WP_000887644.1.44985 WP_000887644.1.44996 WP_000887644.1.44998 WP_000887644.1.45027 WP_000887644.1.45038 WP_000887644.1.45045 WP_000887644.1.45067 WP_000887644.1.45074 WP_000887644.1.45079 WP_000887644.1.45098 WP_000887644.1.45123 WP_000887644.1.45134 WP_000887644.1.45138 WP_000887644.1.45145 WP_000887644.1.45154 WP_000887644.1.45177 WP_000887644.1.45184 WP_000887644.1.45229 WP_000887644.1.45251 WP_000887644.1.45259 WP_000887644.1.45268 WP_000887644.1.45344 WP_000887644.1.45349 WP_000887644.1.45351 WP_000887644.1.45365 WP_000887644.1.4540 WP_000887644.1.45402 WP_000887644.1.45434 WP_000887644.1.45462 WP_000887644.1.45468 WP_000887644.1.45522 WP_000887644.1.45535 WP_000887644.1.45550 WP_000887644.1.45566 WP_000887644.1.45582 WP_000887644.1.45585 WP_000887644.1.45622 WP_000887644.1.45660 WP_000887644.1.45690 WP_000887644.1.45781 WP_000887644.1.45797 WP_000887644.1.458 WP_000887644.1.45848 WP_000887644.1.4592 WP_000887644.1.45984 WP_000887644.1.46011 WP_000887644.1.46069 WP_000887644.1.46091 WP_000887644.1.46112 WP_000887644.1.46173 WP_000887644.1.46174 WP_000887644.1.46187 WP_000887644.1.46203 WP_000887644.1.46205 WP_000887644.1.46232 WP_000887644.1.46243 WP_000887644.1.46278 WP_000887644.1.46299 WP_000887644.1.46303 WP_000887644.1.46323 WP_000887644.1.46345 WP_000887644.1.46358 WP_000887644.1.46406 WP_000887644.1.46434 WP_000887644.1.46444 WP_000887644.1.46499 WP_000887644.1.46572 WP_000887644.1.46595 WP_000887644.1.46637 WP_000887644.1.46675 WP_000887644.1.46689 WP_000887644.1.46693 WP_000887644.1.4671 WP_000887644.1.46749 WP_000887644.1.46803 WP_000887644.1.46804 WP_000887644.1.46930 WP_000887644.1.47005 WP_000887644.1.47008 WP_000887644.1.47057 WP_000887644.1.47067 WP_000887644.1.47214 WP_000887644.1.47389 WP_000887644.1.47429 WP_000887644.1.47442 WP_000887644.1.47448 WP_000887644.1.47460 WP_000887644.1.4747 WP_000887644.1.47472 WP_000887644.1.47492 WP_000887644.1.47506 WP_000887644.1.47579 WP_000887644.1.47587 WP_000887644.1.47614 WP_000887644.1.47621 WP_000887644.1.4769 WP_000887644.1.4770 WP_000887644.1.4775 WP_000887644.1.47767 WP_000887644.1.47799 WP_000887644.1.47817 WP_000887644.1.47902 WP_000887644.1.47992 WP_000887644.1.48124 WP_000887644.1.48132 WP_000887644.1.48215 WP_000887644.1.48242 WP_000887644.1.48244 WP_000887644.1.48253 WP_000887644.1.48262 WP_000887644.1.48268 WP_000887644.1.483 WP_000887644.1.48367 WP_000887644.1.48377 WP_000887644.1.48399 WP_000887644.1.48493 WP_000887644.1.4853 WP_000887644.1.48647 WP_000887644.1.48651 WP_000887644.1.48751 WP_000887644.1.48755 WP_000887644.1.48774 WP_000887644.1.48788 WP_000887644.1.4885 WP_000887644.1.48855 WP_000887644.1.48876 WP_000887644.1.48894 WP_000887644.1.48896 WP_000887644.1.48908 WP_000887644.1.48918 WP_000887644.1.48919 WP_000887644.1.48931 WP_000887644.1.49012 WP_000887644.1.49084 WP_000887644.1.49090 WP_000887644.1.49113 WP_000887644.1.49155 WP_000887644.1.49162 WP_000887644.1.49204 WP_000887644.1.49214 WP_000887644.1.49233 WP_000887644.1.49239 WP_000887644.1.49256 WP_000887644.1.49276 WP_000887644.1.49290 WP_000887644.1.49309 WP_000887644.1.49340 WP_000887644.1.49358 WP_000887644.1.49366 WP_000887644.1.49375 WP_000887644.1.49443 WP_000887644.1.49490 WP_000887644.1.49515 WP_000887644.1.49550 WP_000887644.1.49572 WP_000887644.1.49574 WP_000887644.1.49590 WP_000887644.1.49595 WP_000887644.1.49602 WP_000887644.1.49626 WP_000887644.1.49630 WP_000887644.1.49647 WP_000887644.1.49650 WP_000887644.1.49686 WP_000887644.1.49778 WP_000887644.1.4979 WP_000887644.1.49803 WP_000887644.1.49805 WP_000887644.1.49827 WP_000887644.1.49848 WP_000887644.1.49929 WP_000887644.1.50 WP_000887644.1.50003 WP_000887644.1.50080 WP_000887644.1.50161 WP_000887644.1.50198 WP_000887644.1.50211 WP_000887644.1.50238 WP_000887644.1.50251 WP_000887644.1.50285 WP_000887644.1.50349 WP_000887644.1.50374 WP_000887644.1.50376 WP_000887644.1.50389 WP_000887644.1.50404 WP_000887644.1.50413 WP_000887644.1.50478 WP_000887644.1.50497 WP_000887644.1.50517 WP_000887644.1.50565 WP_000887644.1.50593 WP_000887644.1.50676 WP_000887644.1.50769 WP_000887644.1.50774 WP_000887644.1.50777 WP_000887644.1.50782 WP_000887644.1.50800 WP_000887644.1.50804 WP_000887644.1.50808 WP_000887644.1.5088 WP_000887644.1.50893 WP_000887644.1.50905 WP_000887644.1.50908 WP_000887644.1.50918 WP_000887644.1.50941 WP_000887644.1.50999 WP_000887644.1.51014 WP_000887644.1.51022 WP_000887644.1.51025 WP_000887644.1.51066 WP_000887644.1.51117 WP_000887644.1.5114 WP_000887644.1.51178 WP_000887644.1.51179 WP_000887644.1.51182 WP_000887644.1.51186 WP_000887644.1.51224 WP_000887644.1.5125 WP_000887644.1.51285 WP_000887644.1.51308 WP_000887644.1.51331 WP_000887644.1.5138 WP_000887644.1.51419 WP_000887644.1.51487 WP_000887644.1.51488 WP_000887644.1.51506 WP_000887644.1.51514 WP_000887644.1.51634 WP_000887644.1.51649 WP_000887644.1.51686 WP_000887644.1.51700 WP_000887644.1.51704 WP_000887644.1.51831 WP_000887644.1.51910 WP_000887644.1.51911 WP_000887644.1.51932 WP_000887644.1.51989 WP_000887644.1.52047 WP_000887644.1.52121 WP_000887644.1.52123 WP_000887644.1.52148 WP_000887644.1.52170 WP_000887644.1.52336 WP_000887644.1.52346 WP_000887644.1.52353 WP_000887644.1.52356 WP_000887644.1.52361 WP_000887644.1.52446 WP_000887644.1.52456 WP_000887644.1.52527 WP_000887644.1.52528 WP_000887644.1.52637 WP_000887644.1.52653 WP_000887644.1.52656 WP_000887644.1.52738 WP_000887644.1.52743 WP_000887644.1.52744 WP_000887644.1.52748 WP_000887644.1.52824 WP_000887644.1.52851 WP_000887644.1.52857 WP_000887644.1.52866 WP_000887644.1.52898 WP_000887644.1.52915 WP_000887644.1.52924 WP_000887644.1.52949 WP_000887644.1.52985 WP_000887644.1.53016 WP_000887644.1.53100 WP_000887644.1.5316 WP_000887644.1.53179 WP_000887644.1.53190 WP_000887644.1.53203 WP_000887644.1.53206 WP_000887644.1.53272 WP_000887644.1.53286 WP_000887644.1.53316 WP_000887644.1.53328 WP_000887644.1.5333 WP_000887644.1.53436 WP_000887644.1.53466 WP_000887644.1.53529 WP_000887644.1.53534 WP_000887644.1.53543 WP_000887644.1.53675 WP_000887644.1.53696 WP_000887644.1.53757 WP_000887644.1.53772 WP_000887644.1.53790 WP_000887644.1.53812 WP_000887644.1.53814 WP_000887644.1.53905 WP_000887644.1.5392 WP_000887644.1.54033 WP_000887644.1.54075 WP_000887644.1.54085 WP_000887644.1.54136 WP_000887644.1.5415 WP_000887644.1.54196 WP_000887644.1.542 WP_000887644.1.54209 WP_000887644.1.54271 WP_000887644.1.54273 WP_000887644.1.54274 WP_000887644.1.54319 WP_000887644.1.54324 WP_000887644.1.54333 WP_000887644.1.54364 WP_000887644.1.54400 WP_000887644.1.54469 WP_000887644.1.54522 WP_000887644.1.54526 WP_000887644.1.54558 WP_000887644.1.5456 WP_000887644.1.5459 WP_000887644.1.54607 WP_000887644.1.54644 WP_000887644.1.54662 WP_000887644.1.54722 WP_000887644.1.54749 WP_000887644.1.54764 WP_000887644.1.54774 WP_000887644.1.54814 WP_000887644.1.54822 WP_000887644.1.54827 WP_000887644.1.54845 WP_000887644.1.5485 WP_000887644.1.54992 WP_000887644.1.55008 WP_000887644.1.55073 WP_000887644.1.55152 WP_000887644.1.55156 WP_000887644.1.55166 WP_000887644.1.55224 WP_000887644.1.5523 WP_000887644.1.5525 WP_000887644.1.5527 WP_000887644.1.55285 WP_000887644.1.55294 WP_000887644.1.55325 WP_000887644.1.55361 WP_000887644.1.55430 WP_000887644.1.55475 WP_000887644.1.55477 WP_000887644.1.55496 WP_000887644.1.5552 WP_000887644.1.55528 WP_000887644.1.55545 WP_000887644.1.5555 WP_000887644.1.55554 WP_000887644.1.55557 WP_000887644.1.5560 WP_000887644.1.55614 WP_000887644.1.55623 WP_000887644.1.55647 WP_000887644.1.55672 WP_000887644.1.55680 WP_000887644.1.55718 WP_000887644.1.55743 WP_000887644.1.55768 WP_000887644.1.55782 WP_000887644.1.55803 WP_000887644.1.55853 WP_000887644.1.55973 WP_000887644.1.55993 WP_000887644.1.55995 WP_000887644.1.56002 WP_000887644.1.56004 WP_000887644.1.56026 WP_000887644.1.56059 WP_000887644.1.56069 WP_000887644.1.56082 WP_000887644.1.56097 WP_000887644.1.56100 WP_000887644.1.56105 WP_000887644.1.56152 WP_000887644.1.56222 WP_000887644.1.56238 WP_000887644.1.56244 WP_000887644.1.56286 WP_000887644.1.56303 WP_000887644.1.56304 WP_000887644.1.5633 WP_000887644.1.56354 WP_000887644.1.56368 WP_000887644.1.56370 WP_000887644.1.56389 WP_000887644.1.56396 WP_000887644.1.56413 WP_000887644.1.56414 WP_000887644.1.56420 WP_000887644.1.56438 WP_000887644.1.56468 WP_000887644.1.56512 WP_000887644.1.56559 WP_000887644.1.56560 WP_000887644.1.56597 WP_000887644.1.56601 WP_000887644.1.56614 WP_000887644.1.56615 WP_000887644.1.56642 WP_000887644.1.56647 WP_000887644.1.56660 WP_000887644.1.56671 WP_000887644.1.56682 WP_000887644.1.56824 WP_000887644.1.56875 WP_000887644.1.56877 WP_000887644.1.56905 WP_000887644.1.56950 WP_000887644.1.57000 WP_000887644.1.57076 WP_000887644.1.57168 WP_000887644.1.57187 WP_000887644.1.57232 WP_000887644.1.57233 WP_000887644.1.57344 WP_000887644.1.57356 WP_000887644.1.57377 WP_000887644.1.57399 WP_000887644.1.57418 WP_000887644.1.57433 WP_000887644.1.57494 WP_000887644.1.57495 WP_000887644.1.57510 WP_000887644.1.57515 WP_000887644.1.57521 WP_000887644.1.57529 WP_000887644.1.5753 WP_000887644.1.57555 WP_000887644.1.57576 WP_000887644.1.57601 WP_000887644.1.57607 WP_000887644.1.57641 WP_000887644.1.57709 WP_000887644.1.57710 WP_000887644.1.5774 WP_000887644.1.57763 WP_000887644.1.57778 WP_000887644.1.57781 WP_000887644.1.57797 WP_000887644.1.57857 WP_000887644.1.57862 WP_000887644.1.57890 WP_000887644.1.57891 WP_000887644.1.57902 WP_000887644.1.57978 WP_000887644.1.5801 WP_000887644.1.58131 WP_000887644.1.58144 WP_000887644.1.58153 WP_000887644.1.58157 WP_000887644.1.58239 WP_000887644.1.58251 WP_000887644.1.58334 WP_000887644.1.58358 WP_000887644.1.58372 WP_000887644.1.58407 WP_000887644.1.58416 WP_000887644.1.58418 WP_000887644.1.58442 WP_000887644.1.58451 WP_000887644.1.5846 WP_000887644.1.5854 WP_000887644.1.58548 WP_000887644.1.58564 WP_000887644.1.5858 WP_000887644.1.58604 WP_000887644.1.58633 WP_000887644.1.58662 WP_000887644.1.58669 WP_000887644.1.58698 WP_000887644.1.58744 WP_000887644.1.58745 WP_000887644.1.58749 WP_000887644.1.5878 WP_000887644.1.58803 WP_000887644.1.58834 WP_000887644.1.58836 WP_000887644.1.5886 WP_000887644.1.58861 WP_000887644.1.58932 WP_000887644.1.59006 WP_000887644.1.59084 WP_000887644.1.59094 WP_000887644.1.59097 WP_000887644.1.59148 WP_000887644.1.59224 WP_000887644.1.59236 WP_000887644.1.5929 WP_000887644.1.59294 WP_000887644.1.59295 WP_000887644.1.59321 WP_000887644.1.59335 WP_000887644.1.59375 WP_000887644.1.59412 WP_000887644.1.59420 WP_000887644.1.59439 WP_000887644.1.59458 WP_000887644.1.59490 WP_000887644.1.59508 WP_000887644.1.59512 WP_000887644.1.59521 WP_000887644.1.5953 WP_000887644.1.59604 WP_000887644.1.59636 WP_000887644.1.59648 WP_000887644.1.59684 WP_000887644.1.59694 WP_000887644.1.59755 WP_000887644.1.59771 WP_000887644.1.5979 WP_000887644.1.5993 WP_000887644.1.59933 WP_000887644.1.59953 WP_000887644.1.59979 WP_000887644.1.60004 WP_000887644.1.60008 WP_000887644.1.60015 WP_000887644.1.60021 WP_000887644.1.60069 WP_000887644.1.60106 WP_000887644.1.60140 WP_000887644.1.60155 WP_000887644.1.60209 WP_000887644.1.60213 WP_000887644.1.60226 WP_000887644.1.60285 WP_000887644.1.60330 WP_000887644.1.60370 WP_000887644.1.60379 WP_000887644.1.60464 WP_000887644.1.60469 WP_000887644.1.60486 WP_000887644.1.60503 WP_000887644.1.60507 WP_000887644.1.6052 WP_000887644.1.60545 WP_000887644.1.60561 WP_000887644.1.60608 WP_000887644.1.60622 WP_000887644.1.60760 WP_000887644.1.60772 WP_000887644.1.60794 WP_000887644.1.60851 WP_000887644.1.60857 WP_000887644.1.6086 WP_000887644.1.60863 WP_000887644.1.60874 WP_000887644.1.6090 WP_000887644.1.60941 WP_000887644.1.60976 WP_000887644.1.60990 WP_000887644.1.61045 WP_000887644.1.61078 WP_000887644.1.6108 WP_000887644.1.61087 WP_000887644.1.61114 WP_000887644.1.6114 WP_000887644.1.61184 WP_000887644.1.61218 WP_000887644.1.61232 WP_000887644.1.6129 WP_000887644.1.61296 WP_000887644.1.61417 WP_000887644.1.61497 WP_000887644.1.61509 WP_000887644.1.61519 WP_000887644.1.61574 WP_000887644.1.61582 WP_000887644.1.61609 WP_000887644.1.61667 WP_000887644.1.61712 WP_000887644.1.61714 WP_000887644.1.61730 WP_000887644.1.61732 WP_000887644.1.61737 WP_000887644.1.61743 WP_000887644.1.61857 WP_000887644.1.6190 WP_000887644.1.61918 WP_000887644.1.61922 WP_000887644.1.61924 WP_000887644.1.61952 WP_000887644.1.61968 WP_000887644.1.62007 WP_000887644.1.62020 WP_000887644.1.62025 WP_000887644.1.62076 WP_000887644.1.6209 WP_000887644.1.62108 WP_000887644.1.62120 WP_000887644.1.62122 WP_000887644.1.62144 WP_000887644.1.62184 WP_000887644.1.62204 WP_000887644.1.62219 WP_000887644.1.62222 WP_000887644.1.62241 WP_000887644.1.62245 WP_000887644.1.62257 WP_000887644.1.62271 WP_000887644.1.62304 WP_000887644.1.62339 WP_000887644.1.62344 WP_000887644.1.62364 WP_000887644.1.62374 WP_000887644.1.62403 WP_000887644.1.62486 WP_000887644.1.62504 WP_000887644.1.62522 WP_000887644.1.6253 WP_000887644.1.62564 WP_000887644.1.62570 WP_000887644.1.62619 WP_000887644.1.62648 WP_000887644.1.62677 WP_000887644.1.62693 WP_000887644.1.62798 WP_000887644.1.62853 WP_000887644.1.62903 WP_000887644.1.62910 WP_000887644.1.62955 WP_000887644.1.62976 WP_000887644.1.63063 WP_000887644.1.63118 WP_000887644.1.63129 WP_000887644.1.63135 WP_000887644.1.63150 WP_000887644.1.63155 WP_000887644.1.63181 WP_000887644.1.63186 WP_000887644.1.63203 WP_000887644.1.63256 WP_000887644.1.63290 WP_000887644.1.63382 WP_000887644.1.63432 WP_000887644.1.63455 WP_000887644.1.63461 WP_000887644.1.63479 WP_000887644.1.63499 WP_000887644.1.63513 WP_000887644.1.63532 WP_000887644.1.6357 WP_000887644.1.63577 WP_000887644.1.63633 WP_000887644.1.63664 WP_000887644.1.6367 WP_000887644.1.63690 WP_000887644.1.63718 WP_000887644.1.63731 WP_000887644.1.6375 WP_000887644.1.63757 WP_000887644.1.63766 WP_000887644.1.63781 WP_000887644.1.63782 WP_000887644.1.63797 WP_000887644.1.63831 WP_000887644.1.63834 WP_000887644.1.63860 WP_000887644.1.63864 WP_000887644.1.63866 WP_000887644.1.63903 WP_000887644.1.63912 WP_000887644.1.63958 WP_000887644.1.63977 WP_000887644.1.6399 WP_000887644.1.64018 WP_000887644.1.64034 WP_000887644.1.64046 WP_000887644.1.64072 WP_000887644.1.64121 WP_000887644.1.6423 WP_000887644.1.64244 WP_000887644.1.6437 WP_000887644.1.64374 WP_000887644.1.64387 WP_000887644.1.64403 WP_000887644.1.64412 WP_000887644.1.6451 WP_000887644.1.64649 WP_000887644.1.64690 WP_000887644.1.64702 WP_000887644.1.64757 WP_000887644.1.64781 WP_000887644.1.64798 WP_000887644.1.64831 WP_000887644.1.6489 WP_000887644.1.64894 WP_000887644.1.64919 WP_000887644.1.64944 WP_000887644.1.64977 WP_000887644.1.65018 WP_000887644.1.65022 WP_000887644.1.65028 WP_000887644.1.65171 WP_000887644.1.65185 WP_000887644.1.65248 WP_000887644.1.6525 WP_000887644.1.65269 WP_000887644.1.65295 WP_000887644.1.65348 WP_000887644.1.65363 WP_000887644.1.65437 WP_000887644.1.65474 WP_000887644.1.6550 WP_000887644.1.65508 WP_000887644.1.65538 WP_000887644.1.65558 WP_000887644.1.65572 WP_000887644.1.6560 WP_000887644.1.6561 WP_000887644.1.65633 WP_000887644.1.6565 WP_000887644.1.65696 WP_000887644.1.6572 WP_000887644.1.6575 WP_000887644.1.65782 WP_000887644.1.65795 WP_000887644.1.65849 WP_000887644.1.65876 WP_000887644.1.65940 WP_000887644.1.65956 WP_000887644.1.66049 WP_000887644.1.66082 WP_000887644.1.66085 WP_000887644.1.66122 WP_000887644.1.66235 WP_000887644.1.66250 WP_000887644.1.66272 WP_000887644.1.66289 WP_000887644.1.6630 WP_000887644.1.66314 WP_000887644.1.66330 WP_000887644.1.66358 WP_000887644.1.66362 WP_000887644.1.66368 WP_000887644.1.6638 WP_000887644.1.6640 WP_000887644.1.66462 WP_000887644.1.6647 WP_000887644.1.66492 WP_000887644.1.66600 WP_000887644.1.66630 WP_000887644.1.66678 WP_000887644.1.66698 WP_000887644.1.66702 WP_000887644.1.66779 WP_000887644.1.6680 WP_000887644.1.66800 WP_000887644.1.66820 WP_000887644.1.66825 WP_000887644.1.66834 WP_000887644.1.66876 WP_000887644.1.66901 WP_000887644.1.6692 WP_000887644.1.66937 WP_000887644.1.66962 WP_000887644.1.67 WP_000887644.1.67037 WP_000887644.1.67045 WP_000887644.1.67100 WP_000887644.1.67175 WP_000887644.1.67181 WP_000887644.1.67235 WP_000887644.1.67268 WP_000887644.1.67347 WP_000887644.1.6739 WP_000887644.1.67465 WP_000887644.1.67552 WP_000887644.1.67603 WP_000887644.1.67617 WP_000887644.1.67633 WP_000887644.1.67682 WP_000887644.1.67707 WP_000887644.1.67731 WP_000887644.1.67772 WP_000887644.1.67803 WP_000887644.1.67827 WP_000887644.1.67829 WP_000887644.1.67887 WP_000887644.1.67924 WP_000887644.1.67969 WP_000887644.1.67970 WP_000887644.1.67977 WP_000887644.1.68036 WP_000887644.1.68073 WP_000887644.1.6809 WP_000887644.1.68167 WP_000887644.1.68201 WP_000887644.1.68206 WP_000887644.1.68210 WP_000887644.1.6827 WP_000887644.1.68275 WP_000887644.1.6833 WP_000887644.1.68401 WP_000887644.1.68477 WP_000887644.1.6849 WP_000887644.1.685 WP_000887644.1.68547 WP_000887644.1.6857 WP_000887644.1.68589 WP_000887644.1.68591 WP_000887644.1.68629 WP_000887644.1.68655 WP_000887644.1.68656 WP_000887644.1.68658 WP_000887644.1.68690 WP_000887644.1.68778 WP_000887644.1.68787 WP_000887644.1.68816 WP_000887644.1.6882 WP_000887644.1.6883 WP_000887644.1.68894 WP_000887644.1.68928 WP_000887644.1.68958 WP_000887644.1.68966 WP_000887644.1.68975 WP_000887644.1.69001 WP_000887644.1.69006 WP_000887644.1.69011 WP_000887644.1.69029 WP_000887644.1.6904 WP_000887644.1.6905 WP_000887644.1.69058 WP_000887644.1.6907 WP_000887644.1.6913 WP_000887644.1.69139 WP_000887644.1.69146 WP_000887644.1.69151 WP_000887644.1.69255 WP_000887644.1.69296 WP_000887644.1.69346 WP_000887644.1.69359 WP_000887644.1.69397 WP_000887644.1.69515 WP_000887644.1.6954 WP_000887644.1.69554 WP_000887644.1.69564 WP_000887644.1.69588 WP_000887644.1.69592 WP_000887644.1.69644 WP_000887644.1.69696 WP_000887644.1.69704 WP_000887644.1.69710 WP_000887644.1.69758 WP_000887644.1.69760 WP_000887644.1.69785 WP_000887644.1.69787 WP_000887644.1.69790 WP_000887644.1.69808 WP_000887644.1.69848 WP_000887644.1.69890 WP_000887644.1.69975 WP_000887644.1.69977 WP_000887644.1.70028 WP_000887644.1.70047 WP_000887644.1.70087 WP_000887644.1.7010 WP_000887644.1.70169 WP_000887644.1.70183 WP_000887644.1.7021 WP_000887644.1.70241 WP_000887644.1.70269 WP_000887644.1.70281 WP_000887644.1.70289 WP_000887644.1.70290 WP_000887644.1.70303 WP_000887644.1.70327 WP_000887644.1.70355 WP_000887644.1.7044 WP_000887644.1.70447 WP_000887644.1.70485 WP_000887644.1.7055 WP_000887644.1.70643 WP_000887644.1.70712 WP_000887644.1.70732 WP_000887644.1.70733 WP_000887644.1.70761 WP_000887644.1.70797 WP_000887644.1.70869 WP_000887644.1.70883 WP_000887644.1.70899 WP_000887644.1.70914 WP_000887644.1.70922 WP_000887644.1.70929 WP_000887644.1.7093 WP_000887644.1.70948 WP_000887644.1.70959 WP_000887644.1.70977 WP_000887644.1.70986 WP_000887644.1.71007 WP_000887644.1.71010 WP_000887644.1.71023 WP_000887644.1.71069 WP_000887644.1.71088 WP_000887644.1.71116 WP_000887644.1.71120 WP_000887644.1.71146 WP_000887644.1.71150 WP_000887644.1.71165 WP_000887644.1.71171 WP_000887644.1.71188 WP_000887644.1.71202 WP_000887644.1.71243 WP_000887644.1.71248 WP_000887644.1.71268 WP_000887644.1.71299 WP_000887644.1.71306 WP_000887644.1.71337 WP_000887644.1.7134 WP_000887644.1.71363 WP_000887644.1.71368 WP_000887644.1.71378 WP_000887644.1.714 WP_000887644.1.71401 WP_000887644.1.71407 WP_000887644.1.71418 WP_000887644.1.7142 WP_000887644.1.71450 WP_000887644.1.71452 WP_000887644.1.71481 WP_000887644.1.71500 WP_000887644.1.71583 WP_000887644.1.71600 WP_000887644.1.71636 WP_000887644.1.71667 WP_000887644.1.71691 WP_000887644.1.71702 WP_000887644.1.71746 WP_000887644.1.71750 WP_000887644.1.71798 WP_000887644.1.71845 WP_000887644.1.71881 WP_000887644.1.71908 WP_000887644.1.71923 WP_000887644.1.71941 WP_000887644.1.71952 WP_000887644.1.71973 WP_000887644.1.72068 WP_000887644.1.72105 WP_000887644.1.72107 WP_000887644.1.72119 WP_000887644.1.72182 WP_000887644.1.72188 WP_000887644.1.72203 WP_000887644.1.72220 WP_000887644.1.72234 WP_000887644.1.72243 WP_000887644.1.72277 WP_000887644.1.72281 WP_000887644.1.72283 WP_000887644.1.72351 WP_000887644.1.72372 WP_000887644.1.72376 WP_000887644.1.72382 WP_000887644.1.72403 WP_000887644.1.72412 WP_000887644.1.7243 WP_000887644.1.72438 WP_000887644.1.72470 WP_000887644.1.72594 WP_000887644.1.72625 WP_000887644.1.72629 WP_000887644.1.72642 WP_000887644.1.72671 WP_000887644.1.72728 WP_000887644.1.72827 WP_000887644.1.72843 WP_000887644.1.72850 WP_000887644.1.72871 WP_000887644.1.72872 WP_000887644.1.72887 WP_000887644.1.72892 WP_000887644.1.72894 WP_000887644.1.72897 WP_000887644.1.72944 WP_000887644.1.72968 WP_000887644.1.72975 WP_000887644.1.73062 WP_000887644.1.73125 WP_000887644.1.7315 WP_000887644.1.73164 WP_000887644.1.73200 WP_000887644.1.73328 WP_000887644.1.7334 WP_000887644.1.73362 WP_000887644.1.73377 WP_000887644.1.73379 WP_000887644.1.7341 WP_000887644.1.73461 WP_000887644.1.73481 WP_000887644.1.73512 WP_000887644.1.7356 WP_000887644.1.73561 WP_000887644.1.73581 WP_000887644.1.73596 WP_000887644.1.73617 WP_000887644.1.73667 WP_000887644.1.73669 WP_000887644.1.7374 WP_000887644.1.73753 WP_000887644.1.73758 WP_000887644.1.73764 WP_000887644.1.73794 WP_000887644.1.73804 WP_000887644.1.73847 WP_000887644.1.7386 WP_000887644.1.7387 WP_000887644.1.73901 WP_000887644.1.73924 WP_000887644.1.73926 WP_000887644.1.7394 WP_000887644.1.73945 WP_000887644.1.73956 WP_000887644.1.73965 WP_000887644.1.74028 WP_000887644.1.74029 WP_000887644.1.74040 WP_000887644.1.74049 WP_000887644.1.7405 WP_000887644.1.74089 WP_000887644.1.74117 WP_000887644.1.74181 WP_000887644.1.74191 WP_000887644.1.74228 WP_000887644.1.74379 WP_000887644.1.74402 WP_000887644.1.74410 WP_000887644.1.74414 WP_000887644.1.74418 WP_000887644.1.74428 WP_000887644.1.7444 WP_000887644.1.74454 WP_000887644.1.74466 WP_000887644.1.74469 WP_000887644.1.74481 WP_000887644.1.745 WP_000887644.1.74529 WP_000887644.1.74545 WP_000887644.1.74639 WP_000887644.1.74661 WP_000887644.1.74745 WP_000887644.1.74757 WP_000887644.1.74806 WP_000887644.1.74807 WP_000887644.1.74826 WP_000887644.1.74876 WP_000887644.1.74946 WP_000887644.1.74992 WP_000887644.1.75009 WP_000887644.1.75058 WP_000887644.1.75129 WP_000887644.1.75180 WP_000887644.1.75187 WP_000887644.1.75288 WP_000887644.1.75301 WP_000887644.1.7531 WP_000887644.1.75334 WP_000887644.1.75362 WP_000887644.1.75385 WP_000887644.1.75392 WP_000887644.1.7543 WP_000887644.1.75494 WP_000887644.1.75585 WP_000887644.1.75609 WP_000887644.1.75626 WP_000887644.1.75703 WP_000887644.1.75740 WP_000887644.1.75760 WP_000887644.1.75764 WP_000887644.1.75828 WP_000887644.1.75837 WP_000887644.1.75873 WP_000887644.1.75874 WP_000887644.1.75884 WP_000887644.1.75932 WP_000887644.1.75945 WP_000887644.1.76 WP_000887644.1.76020 WP_000887644.1.76024 WP_000887644.1.76055 WP_000887644.1.76102 WP_000887644.1.76156 WP_000887644.1.76162 WP_000887644.1.76164 WP_000887644.1.76170 WP_000887644.1.76252 WP_000887644.1.76301 WP_000887644.1.76327 WP_000887644.1.7633 WP_000887644.1.7634 WP_000887644.1.76434 WP_000887644.1.76445 WP_000887644.1.76529 WP_000887644.1.76532 WP_000887644.1.76548 WP_000887644.1.7655 WP_000887644.1.7657 WP_000887644.1.76576 WP_000887644.1.7660 WP_000887644.1.76611 WP_000887644.1.76673 WP_000887644.1.76706 WP_000887644.1.7672 WP_000887644.1.76721 WP_000887644.1.76756 WP_000887644.1.76760 WP_000887644.1.76799 WP_000887644.1.7684 WP_000887644.1.76866 WP_000887644.1.76875 WP_000887644.1.76880 WP_000887644.1.76899 WP_000887644.1.77017 WP_000887644.1.77033 WP_000887644.1.77038 WP_000887644.1.77047 WP_000887644.1.77067 WP_000887644.1.77080 WP_000887644.1.7712 WP_000887644.1.77177 WP_000887644.1.77180 WP_000887644.1.77184 WP_000887644.1.77241 WP_000887644.1.77244 WP_000887644.1.77267 WP_000887644.1.77271 WP_000887644.1.77292 WP_000887644.1.77313 WP_000887644.1.77349 WP_000887644.1.77390 WP_000887644.1.77431 WP_000887644.1.77436 WP_000887644.1.77440 WP_000887644.1.77514 WP_000887644.1.77529 WP_000887644.1.77549 WP_000887644.1.77555 WP_000887644.1.77565 WP_000887644.1.77575 WP_000887644.1.77596 WP_000887644.1.77629 WP_000887644.1.77646 WP_000887644.1.77653 WP_000887644.1.77692 WP_000887644.1.77710 WP_000887644.1.77754 WP_000887644.1.77761 WP_000887644.1.7782 WP_000887644.1.77851 WP_000887644.1.77871 WP_000887644.1.77898 WP_000887644.1.77918 WP_000887644.1.77960 WP_000887644.1.77971 WP_000887644.1.78 WP_000887644.1.78016 WP_000887644.1.78026 WP_000887644.1.78033 WP_000887644.1.78053 WP_000887644.1.78076 WP_000887644.1.78096 WP_000887644.1.78100 WP_000887644.1.78110 WP_000887644.1.78120 WP_000887644.1.7814 WP_000887644.1.78170 WP_000887644.1.78245 WP_000887644.1.78259 WP_000887644.1.78301 WP_000887644.1.78366 WP_000887644.1.78372 WP_000887644.1.78383 WP_000887644.1.78407 WP_000887644.1.78495 WP_000887644.1.78496 WP_000887644.1.7861 WP_000887644.1.78618 WP_000887644.1.78673 WP_000887644.1.78735 WP_000887644.1.78738 WP_000887644.1.78771 WP_000887644.1.78789 WP_000887644.1.78802 WP_000887644.1.78830 WP_000887644.1.78835 WP_000887644.1.78838 WP_000887644.1.78871 WP_000887644.1.78874 WP_000887644.1.78881 WP_000887644.1.78913 WP_000887644.1.78918 WP_000887644.1.78930 WP_000887644.1.78951 WP_000887644.1.79011 WP_000887644.1.79032 WP_000887644.1.79081 WP_000887644.1.79140 WP_000887644.1.79151 WP_000887644.1.79167 WP_000887644.1.79189 WP_000887644.1.79203 WP_000887644.1.79302 WP_000887644.1.79335 WP_000887644.1.79370 WP_000887644.1.794 WP_000887644.1.79462 WP_000887644.1.79466 WP_000887644.1.79472 WP_000887644.1.79495 WP_000887644.1.79529 WP_000887644.1.7956 WP_000887644.1.79570 WP_000887644.1.79635 WP_000887644.1.7964 WP_000887644.1.79642 WP_000887644.1.79645 WP_000887644.1.79659 WP_000887644.1.79668 WP_000887644.1.79708 WP_000887644.1.7972 WP_000887644.1.79734 WP_000887644.1.79738 WP_000887644.1.79757 WP_000887644.1.79778 WP_000887644.1.79845 WP_000887644.1.79867 WP_000887644.1.79892 WP_000887644.1.79914 WP_000887644.1.79929 WP_000887644.1.79934 WP_000887644.1.7994 WP_000887644.1.79942 WP_000887644.1.79945 WP_000887644.1.79966 WP_000887644.1.79974 WP_000887644.1.79996 WP_000887644.1.80077 WP_000887644.1.80137 WP_000887644.1.80182 WP_000887644.1.80236 WP_000887644.1.8024 WP_000887644.1.80250 WP_000887644.1.80296 WP_000887644.1.80307 WP_000887644.1.80333 WP_000887644.1.80366 WP_000887644.1.80441 WP_000887644.1.80443 WP_000887644.1.80473 WP_000887644.1.80479 WP_000887644.1.80480 WP_000887644.1.80496 WP_000887644.1.80542 WP_000887644.1.80609 WP_000887644.1.80629 WP_000887644.1.80638 WP_000887644.1.80651 WP_000887644.1.80667 WP_000887644.1.80674 WP_000887644.1.80723 WP_000887644.1.80725 WP_000887644.1.80741 WP_000887644.1.80750 WP_000887644.1.80757 WP_000887644.1.80780 WP_000887644.1.80803 WP_000887644.1.80819 WP_000887644.1.80827 WP_000887644.1.80831 WP_000887644.1.80840 WP_000887644.1.80850 WP_000887644.1.80857 WP_000887644.1.80868 WP_000887644.1.80881 WP_000887644.1.80927 WP_000887644.1.80939 WP_000887644.1.80959 WP_000887644.1.8096 WP_000887644.1.80973 WP_000887644.1.81037 WP_000887644.1.81062 WP_000887644.1.81067 WP_000887644.1.81069 WP_000887644.1.81118 WP_000887644.1.81149 WP_000887644.1.81175 WP_000887644.1.8119 WP_000887644.1.81193 WP_000887644.1.81231 WP_000887644.1.8127 WP_000887644.1.81275 WP_000887644.1.81302 WP_000887644.1.81305 WP_000887644.1.81320 WP_000887644.1.81321 WP_000887644.1.81328 WP_000887644.1.81354 WP_000887644.1.81404 WP_000887644.1.81409 WP_000887644.1.81410 WP_000887644.1.81425 WP_000887644.1.81455 WP_000887644.1.81504 WP_000887644.1.81528 WP_000887644.1.81548 WP_000887644.1.8168 WP_000887644.1.81727 WP_000887644.1.81735 WP_000887644.1.81736 WP_000887644.1.81743 WP_000887644.1.81746 WP_000887644.1.81750 WP_000887644.1.81760 WP_000887644.1.81785 WP_000887644.1.81795 WP_000887644.1.81902 WP_000887644.1.81941 WP_000887644.1.8196 WP_000887644.1.81965 WP_000887644.1.81974 WP_000887644.1.81977 WP_000887644.1.81995 WP_000887644.1.82037 WP_000887644.1.82192 WP_000887644.1.82232 WP_000887644.1.82258 WP_000887644.1.82269 WP_000887644.1.82337 WP_000887644.1.82352 WP_000887644.1.8236 WP_000887644.1.82369 WP_000887644.1.82395 WP_000887644.1.82464 WP_000887644.1.82479 WP_000887644.1.82503 WP_000887644.1.82515 WP_000887644.1.82562 WP_000887644.1.82570 WP_000887644.1.82636 WP_000887644.1.82637 WP_000887644.1.82648 WP_000887644.1.82761 WP_000887644.1.8282 WP_000887644.1.82843 WP_000887644.1.82886 WP_000887644.1.82908 WP_000887644.1.82944 WP_000887644.1.82946 WP_000887644.1.82956 WP_000887644.1.82964 WP_000887644.1.83092 WP_000887644.1.83119 WP_000887644.1.83128 WP_000887644.1.83139 WP_000887644.1.83163 WP_000887644.1.83221 WP_000887644.1.83247 WP_000887644.1.83252 WP_000887644.1.83258 WP_000887644.1.83301 WP_000887644.1.83305 WP_000887644.1.83365 WP_000887644.1.83388 WP_000887644.1.83407 WP_000887644.1.83413 WP_000887644.1.83491 WP_000887644.1.83510 WP_000887644.1.83516 WP_000887644.1.83523 WP_000887644.1.8354 WP_000887644.1.83598 WP_000887644.1.83651 WP_000887644.1.83710 WP_000887644.1.83721 WP_000887644.1.83739 WP_000887644.1.83760 WP_000887644.1.83897 WP_000887644.1.83960 WP_000887644.1.83995 WP_000887644.1.84001 WP_000887644.1.84031 WP_000887644.1.84100 WP_000887644.1.84103 WP_000887644.1.84115 WP_000887644.1.84168 WP_000887644.1.84179 WP_000887644.1.84198 WP_000887644.1.84209 WP_000887644.1.84229 WP_000887644.1.8425 WP_000887644.1.84283 WP_000887644.1.84291 WP_000887644.1.84325 WP_000887644.1.84373 WP_000887644.1.84392 WP_000887644.1.84397 WP_000887644.1.84403 WP_000887644.1.8441 WP_000887644.1.84459 WP_000887644.1.84461 WP_000887644.1.84475 WP_000887644.1.84523 WP_000887644.1.84532 WP_000887644.1.84551 WP_000887644.1.84554 WP_000887644.1.84644 WP_000887644.1.84659 WP_000887644.1.84683 WP_000887644.1.84693 WP_000887644.1.84711 WP_000887644.1.84745 WP_000887644.1.84899 WP_000887644.1.849 WP_000887644.1.8497 WP_000887644.1.850 WP_000887644.1.85014 WP_000887644.1.85031 WP_000887644.1.85040 WP_000887644.1.85094 WP_000887644.1.85126 WP_000887644.1.85134 WP_000887644.1.85147 WP_000887644.1.85178 WP_000887644.1.85180 WP_000887644.1.85190 WP_000887644.1.85192 WP_000887644.1.85217 WP_000887644.1.8533 WP_000887644.1.8537 WP_000887644.1.85408 WP_000887644.1.85433 WP_000887644.1.8545 WP_000887644.1.85456 WP_000887644.1.85483 WP_000887644.1.85541 WP_000887644.1.8556 WP_000887644.1.85568 WP_000887644.1.85615 WP_000887644.1.85617 WP_000887644.1.85663 WP_000887644.1.85671 WP_000887644.1.85672 WP_000887644.1.85675 WP_000887644.1.85723 WP_000887644.1.85742 WP_000887644.1.85777 WP_000887644.1.85780 WP_000887644.1.85784 WP_000887644.1.85797 WP_000887644.1.85855 WP_000887644.1.85864 WP_000887644.1.85886 WP_000887644.1.85900 WP_000887644.1.85904 WP_000887644.1.85943 WP_000887644.1.85976 WP_000887644.1.86007 WP_000887644.1.86010 WP_000887644.1.86017 WP_000887644.1.86043 WP_000887644.1.86092 WP_000887644.1.86120 WP_000887644.1.86159 WP_000887644.1.86173 WP_000887644.1.86224 WP_000887644.1.86240 WP_000887644.1.86284 WP_000887644.1.86306 WP_000887644.1.86316 WP_000887644.1.86335 WP_000887644.1.86356 WP_000887644.1.86389 WP_000887644.1.86442 WP_000887644.1.86450 WP_000887644.1.86469 WP_000887644.1.86580 WP_000887644.1.86588 WP_000887644.1.86593 WP_000887644.1.86601 WP_000887644.1.86634 WP_000887644.1.86656 WP_000887644.1.86658 WP_000887644.1.86661 WP_000887644.1.86676 WP_000887644.1.86699 WP_000887644.1.8671 WP_000887644.1.8672 WP_000887644.1.86735 WP_000887644.1.86744 WP_000887644.1.8678 WP_000887644.1.86807 WP_000887644.1.86810 WP_000887644.1.8684 WP_000887644.1.86860 WP_000887644.1.86895 WP_000887644.1.86902 WP_000887644.1.86906 WP_000887644.1.8691 WP_000887644.1.86921 WP_000887644.1.87095 WP_000887644.1.87143 WP_000887644.1.87148 WP_000887644.1.87219 WP_000887644.1.8722 WP_000887644.1.87282 WP_000887644.1.87283 WP_000887644.1.87323 WP_000887644.1.8736 WP_000887644.1.87365 WP_000887644.1.87460 WP_000887644.1.87493 WP_000887644.1.87552 WP_000887644.1.87584 WP_000887644.1.8767 WP_000887644.1.87687 WP_000887644.1.87695 WP_000887644.1.87760 WP_000887644.1.87779 WP_000887644.1.87813 WP_000887644.1.87899 WP_000887644.1.8792 WP_000887644.1.87936 WP_000887644.1.87999 WP_000887644.1.8800 WP_000887644.1.88014 WP_000887644.1.88019 WP_000887644.1.8809 WP_000887644.1.88136 WP_000887644.1.88165 WP_000887644.1.88174 WP_000887644.1.88214 WP_000887644.1.88222 WP_000887644.1.88244 WP_000887644.1.88264 WP_000887644.1.88291 WP_000887644.1.88293 WP_000887644.1.8837 WP_000887644.1.88393 WP_000887644.1.88423 WP_000887644.1.88483 WP_000887644.1.8849 WP_000887644.1.88609 WP_000887644.1.88620 WP_000887644.1.88624 WP_000887644.1.88683 WP_000887644.1.88698 WP_000887644.1.88703 WP_000887644.1.88762 WP_000887644.1.88776 WP_000887644.1.88792 WP_000887644.1.88845 WP_000887644.1.88902 WP_000887644.1.8891 WP_000887644.1.88942 WP_000887644.1.88957 WP_000887644.1.88970 WP_000887644.1.88980 WP_000887644.1.88981 WP_000887644.1.88982 WP_000887644.1.88995 WP_000887644.1.89054 WP_000887644.1.89114 WP_000887644.1.89116 WP_000887644.1.89119 WP_000887644.1.89138 WP_000887644.1.89174 WP_000887644.1.89188 WP_000887644.1.89215 WP_000887644.1.89291 WP_000887644.1.89304 WP_000887644.1.89355 WP_000887644.1.89452 WP_000887644.1.89462 WP_000887644.1.89512 WP_000887644.1.89527 WP_000887644.1.89570 WP_000887644.1.8958 WP_000887644.1.89580 WP_000887644.1.89604 WP_000887644.1.89622 WP_000887644.1.89632 WP_000887644.1.89647 WP_000887644.1.89657 WP_000887644.1.89659 WP_000887644.1.89765 WP_000887644.1.89777 WP_000887644.1.89789 WP_000887644.1.89815 WP_000887644.1.89817 WP_000887644.1.89870 WP_000887644.1.89902 WP_000887644.1.89914 WP_000887644.1.89940 WP_000887644.1.8996 WP_000887644.1.89965 WP_000887644.1.89975 WP_000887644.1.90033 WP_000887644.1.90084 WP_000887644.1.90097 WP_000887644.1.90108 WP_000887644.1.90193 WP_000887644.1.90211 WP_000887644.1.90252 WP_000887644.1.90293 WP_000887644.1.90311 WP_000887644.1.90417 WP_000887644.1.90453 WP_000887644.1.90458 WP_000887644.1.90472 WP_000887644.1.90521 WP_000887644.1.90557 WP_000887644.1.90585 WP_000887644.1.90620 WP_000887644.1.90641 WP_000887644.1.90686 WP_000887644.1.90701 WP_000887644.1.90734 WP_000887644.1.90792 WP_000887644.1.90814 WP_000887644.1.90876 WP_000887644.1.90878 WP_000887644.1.9093 WP_000887644.1.90984 WP_000887644.1.90991 WP_000887644.1.91003 WP_000887644.1.91023 WP_000887644.1.91042 WP_000887644.1.91049 WP_000887644.1.91056 WP_000887644.1.91069 WP_000887644.1.91107 WP_000887644.1.91156 WP_000887644.1.91179 WP_000887644.1.91189 WP_000887644.1.91278 WP_000887644.1.9131 WP_000887644.1.91334 WP_000887644.1.91381 WP_000887644.1.91453 WP_000887644.1.91459 WP_000887644.1.91473 WP_000887644.1.91493 WP_000887644.1.91512 WP_000887644.1.91524 WP_000887644.1.91564 WP_000887644.1.91579 WP_000887644.1.91580 WP_000887644.1.91621 WP_000887644.1.91625 WP_000887644.1.91628 WP_000887644.1.91655 WP_000887644.1.91724 WP_000887644.1.91732 WP_000887644.1.91788 WP_000887644.1.91806 WP_000887644.1.91864 WP_000887644.1.91880 WP_000887644.1.92013 WP_000887644.1.92039 WP_000887644.1.92044 WP_000887644.1.92060 WP_000887644.1.92067 WP_000887644.1.92068 WP_000887644.1.92093 WP_000887644.1.92099 WP_000887644.1.92108 WP_000887644.1.92122 WP_000887644.1.92149 WP_000887644.1.92165 WP_000887644.1.92171 WP_000887644.1.92183 WP_000887644.1.92208 WP_000887644.1.92213 WP_000887644.1.92268 WP_000887644.1.92270 WP_000887644.1.92310 WP_000887644.1.92318 WP_000887644.1.92375 WP_000887644.1.92394 WP_000887644.1.92408 WP_000887644.1.92411 WP_000887644.1.92443 WP_000887644.1.92482 WP_000887644.1.92531 WP_000887644.1.92562 WP_000887644.1.92575 WP_000887644.1.92659 WP_000887644.1.92669 WP_000887644.1.92671 WP_000887644.1.92738 WP_000887644.1.92754 WP_000887644.1.92758 WP_000887644.1.92827 WP_000887644.1.92832 WP_000887644.1.92836 WP_000887644.1.92843 WP_000887644.1.92875 WP_000887644.1.92879 WP_000887644.1.92893 WP_000887644.1.92895 WP_000887644.1.92939 WP_000887644.1.92988 WP_000887644.1.93059 WP_000887644.1.93061 WP_000887644.1.93086 WP_000887644.1.93101 WP_000887644.1.93136 WP_000887644.1.93155 WP_000887644.1.93213 WP_000887644.1.93275 WP_000887644.1.93322 WP_000887644.1.93339 WP_000887644.1.93365 WP_000887644.1.93376 WP_000887644.1.93410 WP_000887644.1.93543 WP_000887644.1.93604 WP_000887644.1.93648 WP_000887644.1.93650 WP_000887644.1.93656 WP_000887644.1.93662 WP_000887644.1.93671 WP_000887644.1.93691 WP_000887644.1.937 WP_000887644.1.93705 WP_000887644.1.93767 WP_000887644.1.93803 WP_000887644.1.93804 WP_000887644.1.93837 WP_000887644.1.9389 WP_000887644.1.93937 WP_000887644.1.93956 WP_000887644.1.93986 WP_000887644.1.93994 WP_000887644.1.94039 WP_000887644.1.94056 WP_000887644.1.94070 WP_000887644.1.94072 WP_000887644.1.94132 WP_000887644.1.94162 WP_000887644.1.94168 WP_000887644.1.94181 WP_000887644.1.94198 WP_000887644.1.9432 WP_000887644.1.94352 WP_000887644.1.94354 WP_000887644.1.94379 WP_000887644.1.94380 WP_000887644.1.94383 WP_000887644.1.94412 WP_000887644.1.94458 WP_000887644.1.94562 WP_000887644.1.94565 WP_000887644.1.94584 WP_000887644.1.94622 WP_000887644.1.94655 WP_000887644.1.94669 WP_000887644.1.94674 WP_000887644.1.94717 WP_000887644.1.94785 WP_000887644.1.94796 WP_000887644.1.9481 WP_000887644.1.94817 WP_000887644.1.94849 WP_000887644.1.94862 WP_000887644.1.94959 WP_000887644.1.94967 WP_000887644.1.94971 WP_000887644.1.94982 WP_000887644.1.94983 WP_000887644.1.94986 WP_000887644.1.9503 WP_000887644.1.95051 WP_000887644.1.95085 WP_000887644.1.95094 WP_000887644.1.95121 WP_000887644.1.95152 WP_000887644.1.95248 WP_000887644.1.95277 WP_000887644.1.95282 WP_000887644.1.95289 WP_000887644.1.9530 WP_000887644.1.95320 WP_000887644.1.95388 WP_000887644.1.95404 WP_000887644.1.95465 WP_000887644.1.95546 WP_000887644.1.95558 WP_000887644.1.95579 WP_000887644.1.95623 WP_000887644.1.95641 WP_000887644.1.95670 WP_000887644.1.95691 WP_000887644.1.95701 WP_000887644.1.95703 WP_000887644.1.95729 WP_000887644.1.9574 WP_000887644.1.95744 WP_000887644.1.95805 WP_000887644.1.95826 WP_000887644.1.95840 WP_000887644.1.95911 WP_000887644.1.95939 WP_000887644.1.95940 WP_000887644.1.96004 WP_000887644.1.96042 WP_000887644.1.9609 WP_000887644.1.96141 WP_000887644.1.96162 WP_000887644.1.96172 WP_000887644.1.96190 WP_000887644.1.96206 WP_000887644.1.96260 WP_000887644.1.96317 WP_000887644.1.96343 WP_000887644.1.96404 WP_000887644.1.96429 WP_000887644.1.9644 WP_000887644.1.96469 WP_000887644.1.96490 WP_000887644.1.96497 WP_000887644.1.96500 WP_000887644.1.96555 WP_000887644.1.96563 WP_000887644.1.96584 WP_000887644.1.96590 WP_000887644.1.96600 WP_000887644.1.96640 WP_000887644.1.96642 WP_000887644.1.96721 WP_000887644.1.96732 WP_000887644.1.9674 WP_000887644.1.96758 WP_000887644.1.96761 WP_000887644.1.96771 WP_000887644.1.96890 WP_000887644.1.96902 WP_000887644.1.96917 WP_000887644.1.97005 WP_000887644.1.97015 WP_000887644.1.97043 WP_000887644.1.97047 WP_000887644.1.97089 WP_000887644.1.97143 WP_000887644.1.97145 WP_000887644.1.97190 WP_000887644.1.97224 WP_000887644.1.97297 WP_000887644.1.97318 WP_000887644.1.97337 WP_000887644.1.97368 WP_000887644.1.97369 WP_000887644.1.97386 WP_000887644.1.97413 WP_000887644.1.97477 WP_000887644.1.97480 WP_000887644.1.97487 WP_000887644.1.97534 WP_000887644.1.97597 WP_000887644.1.97613 WP_000887644.1.97620 WP_000887644.1.97626 WP_000887644.1.97628 WP_000887644.1.97631 WP_000887644.1.97640 WP_000887644.1.97691 WP_000887644.1.97693 WP_000887644.1.97726 WP_000887644.1.97727 WP_000887644.1.97732 WP_000887644.1.9775 WP_000887644.1.97768 WP_000887644.1.97772 WP_000887644.1.97800 WP_000887644.1.97846 WP_000887644.1.9799 WP_000887644.1.98006 WP_000887644.1.98019 WP_000887644.1.98022 WP_000887644.1.9805 WP_000887644.1.98107 WP_000887644.1.98110 WP_000887644.1.98124 WP_000887644.1.98146 WP_000887644.1.98170 WP_000887644.1.98201 WP_000887644.1.98219 WP_000887644.1.98236 WP_000887644.1.98250 WP_000887644.1.9826 WP_000887644.1.98402 WP_000887644.1.98403 WP_000887644.1.9841 WP_000887644.1.98438 WP_000887644.1.98446 WP_000887644.1.98483 WP_000887644.1.98495 WP_000887644.1.98531 WP_000887644.1.98551 WP_000887644.1.98577 WP_000887644.1.98627 WP_000887644.1.98634 WP_000887644.1.98676 WP_000887644.1.98677 WP_000887644.1.98760 WP_000887644.1.98763 WP_000887644.1.98779 WP_000887644.1.98843 WP_000887644.1.9887 WP_000887644.1.98947 WP_000887644.1.9898 WP_000887644.1.99072 WP_000887644.1.99098 WP_000887644.1.99107 WP_000887644.1.99184 WP_000887644.1.9919 WP_000887644.1.99197 WP_000887644.1.99219 WP_000887644.1.99255 WP_000887644.1.99267 WP_000887644.1.99276 WP_000887644.1.99278 WP_000887644.1.99327 WP_000887644.1.99339 WP_000887644.1.99370 WP_000887644.1.99426 WP_000887644.1.99469 WP_000887644.1.9954 WP_000887644.1.99561 WP_000887644.1.99577 WP_000887644.1.99626 WP_000887644.1.99637 WP_000887644.1.99646 WP_000887644.1.99657 WP_000887644.1.99660 WP_000887644.1.99712 WP_000887644.1.99747 WP_000887644.1.99783 WP_000887644.1.99813 WP_000887644.1.99824 WP_000887644.1.99858 WP_000887644.1.99889 WP_000887644.1.99958 gi|513549441|ref|YP_008119765.1| gi|378983212|ref|YP_005246367.1| gi|16763986|ref|NP_459601.1| gi|452121159|ref|YP_007471407.1| gi|386590537|ref|YP_006086937.1| gi|409249048|ref|YP_006884885.1| gi|62179210|ref|YP_215627.1| gi|563652173|ref|YP_008860231.1| 321314.SC0640 99287.STM0609 gi|525827395|ref|YP_008250000.1| gi|525838970|ref|YP_008256152.1| gi|549478632|ref|YP_008612457.1| gi|549723312|ref|YP_008643502.1| gi|513545521|ref|YP_008083671.1| gi|378988008|ref|YP_005251172.1| gi|538361152|ref|YP_008504437.1| gi|526219475|ref|YP_008264858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]