SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1iutA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iutA
Domain Number 1 Region: 1-172,274-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.75e-59
Family FAD-linked reductases, N-terminal domain 0.000000000209
Further Details:      
 
Domain Number 2 Region: 175-275
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.42e-46
Family PHBH-like 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iutA   PDB: 1iut
Sequence length 394
Comment (A:)
Sequence
MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAG
VDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATT
VYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERV
YPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFW
TELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLN
LAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFS
QRIQQTELEYYLGSEAGLATIAENYVGLPYEEIE
Download sequence
Identical sequences A0A0E1AQI0 A0A2K0BG61 P20586
gi|478476443|ref|YP_007707094.1| NP_248938.1.87394 WP_003112685.1.100319 WP_003112685.1.100523 WP_003112685.1.101047 WP_003112685.1.101310 WP_003112685.1.101712 WP_003112685.1.101809 WP_003112685.1.101871 WP_003112685.1.10419 WP_003112685.1.11180 WP_003112685.1.11410 WP_003112685.1.12120 WP_003112685.1.12547 WP_003112685.1.13057 WP_003112685.1.14455 WP_003112685.1.16197 WP_003112685.1.1739 WP_003112685.1.17697 WP_003112685.1.17890 WP_003112685.1.18653 WP_003112685.1.19703 WP_003112685.1.21471 WP_003112685.1.23418 WP_003112685.1.23518 WP_003112685.1.23884 WP_003112685.1.23925 WP_003112685.1.24234 WP_003112685.1.24879 WP_003112685.1.25964 WP_003112685.1.26042 WP_003112685.1.27858 WP_003112685.1.30254 WP_003112685.1.31361 WP_003112685.1.33387 WP_003112685.1.33549 WP_003112685.1.33669 WP_003112685.1.3531 WP_003112685.1.35480 WP_003112685.1.35669 WP_003112685.1.35843 WP_003112685.1.36148 WP_003112685.1.36521 WP_003112685.1.36608 WP_003112685.1.37216 WP_003112685.1.37799 WP_003112685.1.37826 WP_003112685.1.38337 WP_003112685.1.39046 WP_003112685.1.4038 WP_003112685.1.41502 WP_003112685.1.41773 WP_003112685.1.42294 WP_003112685.1.44760 WP_003112685.1.47155 WP_003112685.1.47645 WP_003112685.1.48413 WP_003112685.1.49833 WP_003112685.1.50653 WP_003112685.1.50967 WP_003112685.1.51682 WP_003112685.1.52334 WP_003112685.1.53037 WP_003112685.1.53530 WP_003112685.1.54146 WP_003112685.1.54462 WP_003112685.1.54974 WP_003112685.1.55347 WP_003112685.1.56037 WP_003112685.1.56229 WP_003112685.1.57113 WP_003112685.1.57853 WP_003112685.1.58482 WP_003112685.1.59013 WP_003112685.1.59123 WP_003112685.1.60979 WP_003112685.1.62263 WP_003112685.1.62357 WP_003112685.1.63038 WP_003112685.1.65066 WP_003112685.1.66410 WP_003112685.1.67489 WP_003112685.1.67899 WP_003112685.1.6850 WP_003112685.1.69330 WP_003112685.1.69834 WP_003112685.1.70470 WP_003112685.1.71642 WP_003112685.1.71927 WP_003112685.1.7276 WP_003112685.1.75631 WP_003112685.1.77490 WP_003112685.1.79007 WP_003112685.1.80481 WP_003112685.1.8051 WP_003112685.1.81206 WP_003112685.1.81771 WP_003112685.1.82312 WP_003112685.1.84271 WP_003112685.1.84487 WP_003112685.1.84715 WP_003112685.1.84754 WP_003112685.1.84792 WP_003112685.1.86058 WP_003112685.1.86287 WP_003112685.1.86293 WP_003112685.1.88004 WP_003112685.1.89610 WP_003112685.1.89886 WP_003112685.1.9182 WP_003112685.1.91938 WP_003112685.1.91996 WP_003112685.1.92175 WP_003112685.1.93122 WP_003112685.1.93493 WP_003112685.1.93797 WP_003112685.1.94218 WP_003112685.1.94221 WP_003112685.1.95018 WP_003112685.1.95207 WP_003112685.1.97271 WP_003112685.1.98522 WP_003112685.1.98600 WP_003112685.1.99103 208964.PA0247 1d7l_A 1doc_A 1dod_A 1doe_A 1ius_A 1iut_A 1iuu_A 1iuv_A 1iuw_A 1iux_A gi|15595444|ref|NP_248938.1| 1iutA gi|564950137|ref|YP_008882707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]