SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1j49A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j49A
Domain Number 1 Region: 104-301
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.42e-51
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000000942
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 7.02e-37
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j49A   PDB: 1j49
Sequence length 333
Comment (A:)
Sequence
mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvyspnaiaehaaiqaarilr
qdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmqimegfgakvitydifrn
pelekkgyyvdslddlykqadvislhvpdvpanvhmindesiakmkqdvvivnvsrgplv
dtdavirgldsgkifgyamdvyegevgifnedwegkefpdarladliarpnvlvtphtaf
ytthavrnmvvkafdnnlelvegkeaetpvkvg
Download sequence
Identical sequences 1j49_A 1j49_B 1j49A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]