SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1j5eJ from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j5eJ
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Ribosomal protein S10 1.68e-35
Family Ribosomal protein S10 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j5eJ   PDB: 1j5e   SUPERFAMILY: 1j5eJ
Sequence length 104
Comment (J:)
Sequence
pkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsre
hfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
Download sequence
Identical sequences 1i94_J 1i95_J 1i96_J 1i97_J 1j5e_J 1n32_J 1n33_J 1n34_J 1n36_J 2e5l_J 2zm6_J 4aqy_J 4b3m_J 4b3r_J 4b3s_J 4b3t_J 4ox9_J 6car_J 6cas_J cath|current|1i94J00/3-100 cath|current|1j5eJ00/3-100 cath|current|1n32J00/3-100 cath|current|1n33J00/3-100 cath|current|1n34J00/3-100 cath|current|1n36J00/3-100 cath|current|2e5lJ00/3-100 1j5eJ

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]