SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1j5kA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j5kA
Domain Number 1 Region: 15-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j5kA   PDB: 1j5k   SUPERFAMILY: 1j5kA
Sequence length 89
Comment (A:)
Sequence
gshmsygdlggpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedri
ititgtqdqiqnaqyllqnsvkqysgkff
Download sequence
Identical sequences 1j5k_A cath|current|1j5kA00/10-85 1j5kA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]