SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1jdpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jdpA
Domain Number 1 Region: 6-393
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-101
Family L-arabinose binding protein-like 0.000000000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jdpA   PDB: 1jdp   SUPERFAMILY: 1jdpA
Sequence length 441
Comment (A:)
Sequence
erealppqkievlvllpqddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvay
edsdcgnralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaag
fqhkdseyshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhev
fqeeglhtsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgd
yaffnielfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssv
ekqglnmedyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagq
vsidangdrygdfsviamtdveagtqevigdyfgkegrfemrpnvkypwgplklridenr
ivehtnsspckscgleesavt
Download sequence
Identical sequences 1jdpA 1jdn_A 1jdp_A 1jdp_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]