SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1jftA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jftA
Domain Number 1 Region: 58-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.49e-118
Family L-arabinose binding protein-like 0.00000000347
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.73e-22
Family GalR/LacI-like bacterial regulator 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jftA   PDB: 1jft
Sequence length 340
Comment (A:)
Sequence
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
mcseypepllamleeyrhipmvvmdageakadftdavidnafeggymagrylierghrei
gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
Download sequence
Identical sequences 1jftA 1jft_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]