SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jhzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jhzA
Domain Number 1 Region: 7-280
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.31e-118
Family L-arabinose binding protein-like 0.00000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jhzA   PDB: 1jhz   SUPERFAMILY: 1jhzA
Sequence length 289
Comment (A:)
Sequence
slkvnhtksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmma
qkrvdgllvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagry
lierghreigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqq
ilsqphrptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihq
pkdslgetafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
Download sequence
Identical sequences 1jhz_A 1jhz_B 1jhzA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]