SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1jnrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jnrA
Domain Number 1 Region: 3-275,420-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.45e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000000301
Further Details:      
 
Domain Number 2 Region: 257-400
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5.6e-64
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000469
Further Details:      
 
Domain Number 3 Region: 507-641
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 5.86e-46
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0000000751
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jnrA   PDB: 1jnr
Sequence length 643
Comment (A:)
Sequence
mvyypkkyelykadevptevvetdiliigggfsgcgaayeaaywaklgglkvtlvekaav
ersgavaqglsaintyidltgrserqntledyvryvtldmmglaredlvadyarhvdgtv
hlfekwglpiwktpdgkyvregqwqimihgesykpiiaeaakmavgeeniyervfifell
kdnndpnavagavgfsvrepkfyvfkakavilatggatllfrprstgeaagrtwyaifdt
gsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeeyiktraael
ekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafe
dfldmtvsqallwacqnidpqeqpseaapaepyimgshsgeagfwvcgpedlmpeeyakl
fplkynrmttvkglfaigdcaganphkfssgsftegriaakaavrfileqkpnpeiddav
veelkkkayapmerfmqykdlstaddvnpeyilpwqglvrlqkimdeyaagiatiyktne
kmlqralellaflkedleklaardlhelmrawelvhrvwtaeahvrhmlfrketrwpgyy
yrtdypelndeewkcfvcskydaekdewtfekvpyvqviewsf
Download sequence
Identical sequences 1jnr_A 1jnr_C 1jnz_A 1jnz_C 1jnrA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]