SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ju2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ju2A
Domain Number 1 Region: 4-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.7e-52
Family FAD-linked reductases, N-terminal domain 0.0000000000592
Further Details:      
 
Domain Number 2 Region: 296-463
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.69e-38
Family GMC oxidoreductases 0.0000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ju2A   PDB: 1ju2
Sequence length 536
Comment (A:)
Sequence
lattsdhdfsylsfaydatdlelegsydyvivgggtsgcplaatlsekykvlvlergslp
taypnvltadgfvynlqqeddgktpverfvsedgidnvrgrvlggtsiinagvyarants
iysasgvdwdmdlvnqtyewvedtivykpnsqswqsvtktafleagvhpnhgfsldheeg
tritgstfdnkgtrhaadellnkgnsnnlrvgvhasvekiifsnapgltatgviyrdsng
tphqafvrskgevivsagtigtpqllllsgvgpesylsslnipvvlshpyvgqflhdnpr
nfinilppnpieptivtvlgisndfyqcsfsslpfttppfgffpsssyplpnstfahfas
kvagplsygsltlksssnvrvspnvkfnyysnltdlshcvsgmkkigellstdalkpykv
edlpgvegfnilgiplpkdqtddaafetfcresvasywhyhggclvgkvldgdfrvtgin
alrvvdgstfpytpashpqgfylmlgryvgikilqersasdlkildslksaaslvl
Download sequence
Identical sequences 1ju2A 1ju2_A 1ju2_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]