SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1jyfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jyfA
Domain Number 1 Region: 63-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.83e-75
Family L-arabinose binding protein-like 0.00000000193
Further Details:      
 
Domain Number 2 Region: 4-49
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.01e-24
Family GalR/LacI-like bacterial regulator 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jyfA   PDB: 1jyf   SUPERFAMILY: 1jyfA
Sequence length 349
Comment (A:)
Sequence
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmql
Download sequence
Identical sequences 1jyfA 1jyf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]