SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1k3kA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1k3kA
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 8.96e-34
Family Bcl-2 inhibitors of programmed cell death 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1k3kA   PDB: 1k3k   SUPERFAMILY: 1k3kA
Sequence length 158
Comment (A:)
Sequence
mdedvlpgevlaiegifmacglnepeylyhpllspiklyitglmrdkeslfeamlanvrf
hsttgidqlglsmlqvsgdgnmnwgralailtfgsfvaqklsnephlrdfalavlpayay
eaigpqwfrarggwrglkayctqvltddddlehhhhhh
Download sequence
Identical sequences 1k3kA 1k3k_A cath|current|1k3kA00/1-146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]