SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1kf6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kf6A
Domain Number 1 Region: 2-250,361-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.26e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000659
Further Details:      
 
Domain Number 2 Region: 436-581
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 8.79e-61
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000016
Further Details:      
 
Domain Number 3 Region: 227-358
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 6.84e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kf6A   PDB: 1kf6
Sequence length 602
Comment (A:)
Sequence
MQTFQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVAQDH
DSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDGSVNVRRFGGM
KIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILVDDGHVRGLVAMNMMEGT
LVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGVPLRDMEFVQYHPTGLPGS
GILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNKYMELGPRDKVSQAFWHEWR
KGNTISTPRGDVVYLDLRHLGEKKLHERLPFICELAKAYVGVDPVKEPIPVRPTAHYTMG
GIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAELVVFGRLAGEQATERAATAGN
GNEAAIEAQAAGVEQRLKDLVNQDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKL
AELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGC
TERDDVNFLKHTLAFRDADGTTRLEYSDVKITTLPPAKRVYGGEADAADKAEAANKKEKA
NG
Download sequence
Identical sequences A0A023Z6Q8 A0A024KNA7 A0A025CM19 A0A026V1H2 A0A062Y303 A0A064T1I3 A0A069XRH4 A0A070FIM1 A0A070UHC1 A0A073G028 A0A074HIB3 A0A080FQ57 A0A080I4C3 A0A090NCG9 A0A0A0F6G9 A0A0A7A2I3 A0A0E0U844 A0A0E0Y8K8 A0A0E1T4I2 A0A0E2TKI8 A0A0G3KHE1 A0A0H7PD55 A0A0K9TIY3 A0A0M7MZS8 A0A125WV42 A0A140NCT2 A0A142GY58 A0A1S6TJ40 A0A1S9KEI6 A0A1X3HXU4 A0A1X3IHR7 A0A1X3J6V9 A0A1X3J8J9 A0A1X3KUM5 A0A1X3L815 A0A1X3M2I2 A0A222QUW0 A0A237FBQ8 A0A2A2XIR3 A7ZV27 B3X5T0 B6I263 B7LC15 B7LLT8 B7NG93 C3SGA7 D3GV56 D6I453 D6IH97 D6J5D4 D7XAT8 D7XSC8 D7YA14 D7ZGQ1 D8E3P3 E0J043 E1IVG9 E1J2P8 E3XLY5 E6BJJ4 E7SXI1 E9TDT2 E9XRM9 E9YWV1 F3VEP9 F4NKF7 F4TP61 F4UXZ1 F4VMF0 G0F4W3 H4IJZ4 H4J0V0 H4KQY7 H4LL53 I0VYE4 I2RBU5 I2W9G1 I2XFM1 I4T6D0 J7RXN6 L2VDK6 L2X395 L3BW29 L3PGC0 L3Q3W9 L4JLX6 L4UY06 M9GLX3 P00363 Q328H0 S0VD76 S1D023 S1E559 S1HM30 S1IBI3 S1IRC5 T5ZNH5 T8ZUL9 T9C236 T9S789 U9Y3C3 U9Y5P8 U9YTN0 V0A7C9 V0AEQ3 V0Z043 V2QK92 V2SMU9 V6G130 V8KGT7 W0FUM7 W1B0C9 W1F215
gi|218697906|ref|YP_002405573.1| gi|386712101|ref|YP_006175822.1| gi|407484078|ref|YP_006781228.1| gi|218707770|ref|YP_002415289.1| gi|218551426|ref|YP_002385218.1| gi|170083603|ref|YP_001732923.1| gi|383181486|ref|YP_005459491.1| gi|410484621|ref|YP_006772167.1| gi|388480104|ref|YP_492299.1| gi|254164088|ref|YP_003047196.1| 1kf6_A 1kf6_M 1kfy_A 1kfy_M 1l0v_A 1l0v_M 6awf_A 6awf_E gi|560160490|ref|YP_008853205.1| gi|387623787|ref|YP_006131415.1| gi|170021833|ref|YP_001726787.1| 300267.SDY_4398 316385.ECDH10B_4349 316407.frdA 331111.EcE24377A_4713 409438.ECSE_4456 413997.ECB_04026 469008.ECBD_3875 481805.EcolC_3856 511145.b4154 585034.ECIAI1_4391 585054.EFER_4208 585055.EC55989_4711 585056.ECUMN_4690 595496.BWG_3869 gi|82779427|ref|YP_405776.1| gi|16131979|ref|NP_418578.1| gi|251787409|ref|YP_003001713.1| NP_418578.1.90541 WP_001192973.1.1000 WP_001192973.1.100044 WP_001192973.1.100085 WP_001192973.1.100138 WP_001192973.1.100159 WP_001192973.1.100194 WP_001192973.1.100251 WP_001192973.1.100285 WP_001192973.1.100346 WP_001192973.1.100389 WP_001192973.1.100441 WP_001192973.1.100444 WP_001192973.1.100451 WP_001192973.1.100487 WP_001192973.1.100496 WP_001192973.1.100499 WP_001192973.1.10051 WP_001192973.1.100531 WP_001192973.1.100573 WP_001192973.1.100614 WP_001192973.1.10067 WP_001192973.1.10068 WP_001192973.1.100689 WP_001192973.1.100718 WP_001192973.1.100796 WP_001192973.1.10080 WP_001192973.1.100803 WP_001192973.1.100824 WP_001192973.1.100851 WP_001192973.1.10086 WP_001192973.1.100867 WP_001192973.1.100868 WP_001192973.1.100916 WP_001192973.1.100928 WP_001192973.1.10094 WP_001192973.1.100950 WP_001192973.1.100966 WP_001192973.1.100990 WP_001192973.1.10100 WP_001192973.1.101033 WP_001192973.1.101096 WP_001192973.1.1011 WP_001192973.1.101102 WP_001192973.1.101158 WP_001192973.1.101186 WP_001192973.1.101214 WP_001192973.1.101255 WP_001192973.1.10126 WP_001192973.1.101282 WP_001192973.1.101289 WP_001192973.1.101293 WP_001192973.1.101313 WP_001192973.1.101359 WP_001192973.1.101387 WP_001192973.1.101418 WP_001192973.1.101423 WP_001192973.1.101518 WP_001192973.1.101583 WP_001192973.1.101651 WP_001192973.1.101654 WP_001192973.1.101686 WP_001192973.1.10173 WP_001192973.1.101737 WP_001192973.1.101747 WP_001192973.1.101822 WP_001192973.1.10184 WP_001192973.1.101845 WP_001192973.1.10187 WP_001192973.1.10188 WP_001192973.1.101889 WP_001192973.1.10190 WP_001192973.1.101900 WP_001192973.1.101937 WP_001192973.1.101947 WP_001192973.1.101948 WP_001192973.1.101962 WP_001192973.1.101964 WP_001192973.1.101969 WP_001192973.1.101977 WP_001192973.1.101987 WP_001192973.1.102021 WP_001192973.1.10222 WP_001192973.1.10233 WP_001192973.1.10235 WP_001192973.1.10252 WP_001192973.1.10304 WP_001192973.1.1040 WP_001192973.1.10417 WP_001192973.1.10491 WP_001192973.1.10524 WP_001192973.1.10569 WP_001192973.1.10576 WP_001192973.1.1058 WP_001192973.1.10605 WP_001192973.1.10651 WP_001192973.1.10673 WP_001192973.1.10705 WP_001192973.1.1071 WP_001192973.1.10715 WP_001192973.1.10729 WP_001192973.1.10744 WP_001192973.1.10748 WP_001192973.1.10787 WP_001192973.1.10809 WP_001192973.1.10824 WP_001192973.1.10862 WP_001192973.1.10922 WP_001192973.1.10940 WP_001192973.1.10988 WP_001192973.1.10989 WP_001192973.1.10994 WP_001192973.1.11006 WP_001192973.1.11032 WP_001192973.1.11047 WP_001192973.1.11052 WP_001192973.1.11068 WP_001192973.1.11071 WP_001192973.1.11118 WP_001192973.1.11121 WP_001192973.1.1113 WP_001192973.1.11265 WP_001192973.1.11408 WP_001192973.1.11418 WP_001192973.1.11436 WP_001192973.1.11437 WP_001192973.1.11542 WP_001192973.1.11578 WP_001192973.1.11595 WP_001192973.1.11645 WP_001192973.1.11673 WP_001192973.1.11699 WP_001192973.1.1176 WP_001192973.1.11801 WP_001192973.1.11803 WP_001192973.1.11844 WP_001192973.1.1186 WP_001192973.1.11955 WP_001192973.1.1196 WP_001192973.1.11982 WP_001192973.1.11985 WP_001192973.1.12000 WP_001192973.1.12030 WP_001192973.1.12036 WP_001192973.1.12051 WP_001192973.1.12060 WP_001192973.1.12112 WP_001192973.1.12115 WP_001192973.1.1212 WP_001192973.1.1218 WP_001192973.1.12319 WP_001192973.1.12320 WP_001192973.1.12344 WP_001192973.1.12352 WP_001192973.1.12415 WP_001192973.1.1242 WP_001192973.1.12426 WP_001192973.1.12458 WP_001192973.1.12459 WP_001192973.1.12468 WP_001192973.1.12478 WP_001192973.1.12542 WP_001192973.1.12574 WP_001192973.1.12582 WP_001192973.1.12594 WP_001192973.1.12623 WP_001192973.1.12646 WP_001192973.1.12675 WP_001192973.1.12680 WP_001192973.1.12693 WP_001192973.1.12697 WP_001192973.1.127 WP_001192973.1.12717 WP_001192973.1.1275 WP_001192973.1.12756 WP_001192973.1.12762 WP_001192973.1.12766 WP_001192973.1.12781 WP_001192973.1.1280 WP_001192973.1.12831 WP_001192973.1.12876 WP_001192973.1.12893 WP_001192973.1.12911 WP_001192973.1.12914 WP_001192973.1.12944 WP_001192973.1.12979 WP_001192973.1.12987 WP_001192973.1.13002 WP_001192973.1.13015 WP_001192973.1.13031 WP_001192973.1.13074 WP_001192973.1.1308 WP_001192973.1.1312 WP_001192973.1.1315 WP_001192973.1.13176 WP_001192973.1.13239 WP_001192973.1.13252 WP_001192973.1.13281 WP_001192973.1.13295 WP_001192973.1.13301 WP_001192973.1.13333 WP_001192973.1.13346 WP_001192973.1.1335 WP_001192973.1.1345 WP_001192973.1.13451 WP_001192973.1.13469 WP_001192973.1.13473 WP_001192973.1.13525 WP_001192973.1.13585 WP_001192973.1.13601 WP_001192973.1.13608 WP_001192973.1.13618 WP_001192973.1.13624 WP_001192973.1.13644 WP_001192973.1.13656 WP_001192973.1.13664 WP_001192973.1.13672 WP_001192973.1.13791 WP_001192973.1.13824 WP_001192973.1.13877 WP_001192973.1.13891 WP_001192973.1.13924 WP_001192973.1.13944 WP_001192973.1.13949 WP_001192973.1.13974 WP_001192973.1.14042 WP_001192973.1.14070 WP_001192973.1.14154 WP_001192973.1.1419 WP_001192973.1.14199 WP_001192973.1.14277 WP_001192973.1.14292 WP_001192973.1.14304 WP_001192973.1.14346 WP_001192973.1.1439 WP_001192973.1.14398 WP_001192973.1.14432 WP_001192973.1.14451 WP_001192973.1.14468 WP_001192973.1.14508 WP_001192973.1.14529 WP_001192973.1.14536 WP_001192973.1.14582 WP_001192973.1.14600 WP_001192973.1.14601 WP_001192973.1.1461 WP_001192973.1.14678 WP_001192973.1.14687 WP_001192973.1.1470 WP_001192973.1.14711 WP_001192973.1.14746 WP_001192973.1.14749 WP_001192973.1.14811 WP_001192973.1.14833 WP_001192973.1.1486 WP_001192973.1.14879 WP_001192973.1.14956 WP_001192973.1.14958 WP_001192973.1.14992 WP_001192973.1.15041 WP_001192973.1.1508 WP_001192973.1.15090 WP_001192973.1.1510 WP_001192973.1.15117 WP_001192973.1.1512 WP_001192973.1.15121 WP_001192973.1.15177 WP_001192973.1.15193 WP_001192973.1.15207 WP_001192973.1.15221 WP_001192973.1.15245 WP_001192973.1.15252 WP_001192973.1.15259 WP_001192973.1.15270 WP_001192973.1.15277 WP_001192973.1.15282 WP_001192973.1.15287 WP_001192973.1.153 WP_001192973.1.15332 WP_001192973.1.15347 WP_001192973.1.15377 WP_001192973.1.15416 WP_001192973.1.1543 WP_001192973.1.15444 WP_001192973.1.15453 WP_001192973.1.15464 WP_001192973.1.15469 WP_001192973.1.15496 WP_001192973.1.1550 WP_001192973.1.15521 WP_001192973.1.15538 WP_001192973.1.15583 WP_001192973.1.15600 WP_001192973.1.1561 WP_001192973.1.15645 WP_001192973.1.15707 WP_001192973.1.15740 WP_001192973.1.15747 WP_001192973.1.15752 WP_001192973.1.15762 WP_001192973.1.15767 WP_001192973.1.15791 WP_001192973.1.15809 WP_001192973.1.15855 WP_001192973.1.15869 WP_001192973.1.1588 WP_001192973.1.15894 WP_001192973.1.15906 WP_001192973.1.15945 WP_001192973.1.15949 WP_001192973.1.15951 WP_001192973.1.16014 WP_001192973.1.16034 WP_001192973.1.16042 WP_001192973.1.16086 WP_001192973.1.1609 WP_001192973.1.16154 WP_001192973.1.16171 WP_001192973.1.16179 WP_001192973.1.16183 WP_001192973.1.16270 WP_001192973.1.16294 WP_001192973.1.163 WP_001192973.1.16387 WP_001192973.1.16388 WP_001192973.1.16435 WP_001192973.1.16482 WP_001192973.1.16500 WP_001192973.1.16532 WP_001192973.1.16539 WP_001192973.1.16541 WP_001192973.1.1655 WP_001192973.1.16577 WP_001192973.1.16592 WP_001192973.1.16612 WP_001192973.1.16648 WP_001192973.1.16669 WP_001192973.1.16682 WP_001192973.1.16685 WP_001192973.1.16700 WP_001192973.1.16721 WP_001192973.1.1673 WP_001192973.1.16745 WP_001192973.1.16766 WP_001192973.1.16805 WP_001192973.1.16818 WP_001192973.1.16979 WP_001192973.1.16992 WP_001192973.1.17018 WP_001192973.1.17061 WP_001192973.1.17084 WP_001192973.1.17085 WP_001192973.1.17087 WP_001192973.1.1710 WP_001192973.1.17101 WP_001192973.1.17102 WP_001192973.1.17109 WP_001192973.1.17111 WP_001192973.1.17114 WP_001192973.1.17119 WP_001192973.1.17123 WP_001192973.1.17150 WP_001192973.1.17153 WP_001192973.1.17170 WP_001192973.1.17172 WP_001192973.1.17182 WP_001192973.1.17186 WP_001192973.1.17216 WP_001192973.1.17230 WP_001192973.1.17241 WP_001192973.1.17242 WP_001192973.1.17282 WP_001192973.1.17297 WP_001192973.1.17356 WP_001192973.1.17360 WP_001192973.1.17386 WP_001192973.1.17389 WP_001192973.1.17403 WP_001192973.1.17410 WP_001192973.1.17432 WP_001192973.1.17496 WP_001192973.1.17550 WP_001192973.1.17568 WP_001192973.1.17577 WP_001192973.1.17595 WP_001192973.1.1763 WP_001192973.1.1769 WP_001192973.1.17701 WP_001192973.1.1772 WP_001192973.1.17766 WP_001192973.1.17769 WP_001192973.1.1778 WP_001192973.1.17802 WP_001192973.1.17829 WP_001192973.1.17920 WP_001192973.1.17937 WP_001192973.1.17984 WP_001192973.1.18000 WP_001192973.1.18006 WP_001192973.1.18050 WP_001192973.1.18064 WP_001192973.1.18094 WP_001192973.1.18134 WP_001192973.1.18141 WP_001192973.1.18164 WP_001192973.1.18175 WP_001192973.1.18226 WP_001192973.1.18229 WP_001192973.1.18275 WP_001192973.1.18311 WP_001192973.1.18329 WP_001192973.1.18338 WP_001192973.1.18381 WP_001192973.1.18383 WP_001192973.1.18402 WP_001192973.1.18410 WP_001192973.1.1844 WP_001192973.1.18482 WP_001192973.1.18519 WP_001192973.1.18530 WP_001192973.1.18550 WP_001192973.1.18588 WP_001192973.1.1861 WP_001192973.1.18617 WP_001192973.1.18649 WP_001192973.1.18650 WP_001192973.1.18651 WP_001192973.1.18655 WP_001192973.1.1866 WP_001192973.1.18666 WP_001192973.1.1867 WP_001192973.1.18675 WP_001192973.1.18699 WP_001192973.1.18714 WP_001192973.1.18726 WP_001192973.1.1873 WP_001192973.1.18794 WP_001192973.1.18843 WP_001192973.1.18861 WP_001192973.1.18876 WP_001192973.1.18899 WP_001192973.1.18929 WP_001192973.1.18936 WP_001192973.1.18966 WP_001192973.1.18983 WP_001192973.1.1903 WP_001192973.1.19075 WP_001192973.1.1909 WP_001192973.1.19100 WP_001192973.1.19114 WP_001192973.1.19147 WP_001192973.1.1915 WP_001192973.1.19150 WP_001192973.1.19194 WP_001192973.1.19206 WP_001192973.1.1925 WP_001192973.1.19276 WP_001192973.1.19277 WP_001192973.1.193 WP_001192973.1.19312 WP_001192973.1.19315 WP_001192973.1.19347 WP_001192973.1.19361 WP_001192973.1.19389 WP_001192973.1.19441 WP_001192973.1.19448 WP_001192973.1.19478 WP_001192973.1.1952 WP_001192973.1.19544 WP_001192973.1.19557 WP_001192973.1.19581 WP_001192973.1.19602 WP_001192973.1.1963 WP_001192973.1.19644 WP_001192973.1.19649 WP_001192973.1.19655 WP_001192973.1.19661 WP_001192973.1.19684 WP_001192973.1.19691 WP_001192973.1.19778 WP_001192973.1.19795 WP_001192973.1.1982 WP_001192973.1.19830 WP_001192973.1.19845 WP_001192973.1.19878 WP_001192973.1.19889 WP_001192973.1.19940 WP_001192973.1.19957 WP_001192973.1.19994 WP_001192973.1.20133 WP_001192973.1.20151 WP_001192973.1.20157 WP_001192973.1.20159 WP_001192973.1.20166 WP_001192973.1.20178 WP_001192973.1.20183 WP_001192973.1.20215 WP_001192973.1.20251 WP_001192973.1.20277 WP_001192973.1.20308 WP_001192973.1.20318 WP_001192973.1.20325 WP_001192973.1.20331 WP_001192973.1.20370 WP_001192973.1.20483 WP_001192973.1.20493 WP_001192973.1.20506 WP_001192973.1.20515 WP_001192973.1.20536 WP_001192973.1.20549 WP_001192973.1.20596 WP_001192973.1.20609 WP_001192973.1.2063 WP_001192973.1.20691 WP_001192973.1.20724 WP_001192973.1.20730 WP_001192973.1.20737 WP_001192973.1.2075 WP_001192973.1.20765 WP_001192973.1.20785 WP_001192973.1.20824 WP_001192973.1.20831 WP_001192973.1.20841 WP_001192973.1.20848 WP_001192973.1.2089 WP_001192973.1.20958 WP_001192973.1.20982 WP_001192973.1.2100 WP_001192973.1.21017 WP_001192973.1.21033 WP_001192973.1.21057 WP_001192973.1.21122 WP_001192973.1.21129 WP_001192973.1.21255 WP_001192973.1.21277 WP_001192973.1.21320 WP_001192973.1.21336 WP_001192973.1.21395 WP_001192973.1.2142 WP_001192973.1.21441 WP_001192973.1.21450 WP_001192973.1.21470 WP_001192973.1.21573 WP_001192973.1.21578 WP_001192973.1.21596 WP_001192973.1.21628 WP_001192973.1.21637 WP_001192973.1.2164 WP_001192973.1.21661 WP_001192973.1.21696 WP_001192973.1.21733 WP_001192973.1.21756 WP_001192973.1.21758 WP_001192973.1.21771 WP_001192973.1.21823 WP_001192973.1.21887 WP_001192973.1.21895 WP_001192973.1.21915 WP_001192973.1.2198 WP_001192973.1.21992 WP_001192973.1.22060 WP_001192973.1.22113 WP_001192973.1.22138 WP_001192973.1.22204 WP_001192973.1.22269 WP_001192973.1.22295 WP_001192973.1.22314 WP_001192973.1.22325 WP_001192973.1.22350 WP_001192973.1.22359 WP_001192973.1.22363 WP_001192973.1.22431 WP_001192973.1.22494 WP_001192973.1.22571 WP_001192973.1.22572 WP_001192973.1.22574 WP_001192973.1.22579 WP_001192973.1.22599 WP_001192973.1.22631 WP_001192973.1.22649 WP_001192973.1.22662 WP_001192973.1.22669 WP_001192973.1.22691 WP_001192973.1.22756 WP_001192973.1.22759 WP_001192973.1.22765 WP_001192973.1.22783 WP_001192973.1.22809 WP_001192973.1.22814 WP_001192973.1.22827 WP_001192973.1.22830 WP_001192973.1.22846 WP_001192973.1.22875 WP_001192973.1.22878 WP_001192973.1.22885 WP_001192973.1.22908 WP_001192973.1.22988 WP_001192973.1.2300 WP_001192973.1.23026 WP_001192973.1.23035 WP_001192973.1.23044 WP_001192973.1.23045 WP_001192973.1.23090 WP_001192973.1.23092 WP_001192973.1.23105 WP_001192973.1.23285 WP_001192973.1.23290 WP_001192973.1.23299 WP_001192973.1.23352 WP_001192973.1.23376 WP_001192973.1.23383 WP_001192973.1.23388 WP_001192973.1.23393 WP_001192973.1.23511 WP_001192973.1.23520 WP_001192973.1.2362 WP_001192973.1.23640 WP_001192973.1.23676 WP_001192973.1.23752 WP_001192973.1.23765 WP_001192973.1.23855 WP_001192973.1.23886 WP_001192973.1.23914 WP_001192973.1.23915 WP_001192973.1.23945 WP_001192973.1.23950 WP_001192973.1.23953 WP_001192973.1.24045 WP_001192973.1.24068 WP_001192973.1.24089 WP_001192973.1.24122 WP_001192973.1.2413 WP_001192973.1.24170 WP_001192973.1.24194 WP_001192973.1.24278 WP_001192973.1.2428 WP_001192973.1.2430 WP_001192973.1.24304 WP_001192973.1.24316 WP_001192973.1.24362 WP_001192973.1.24374 WP_001192973.1.24381 WP_001192973.1.24383 WP_001192973.1.24458 WP_001192973.1.24473 WP_001192973.1.24483 WP_001192973.1.24485 WP_001192973.1.24499 WP_001192973.1.24575 WP_001192973.1.24592 WP_001192973.1.24616 WP_001192973.1.24634 WP_001192973.1.24641 WP_001192973.1.24693 WP_001192973.1.24703 WP_001192973.1.24752 WP_001192973.1.24758 WP_001192973.1.24799 WP_001192973.1.24849 WP_001192973.1.24854 WP_001192973.1.24876 WP_001192973.1.24926 WP_001192973.1.24929 WP_001192973.1.24939 WP_001192973.1.24946 WP_001192973.1.24960 WP_001192973.1.24968 WP_001192973.1.24984 WP_001192973.1.25039 WP_001192973.1.2504 WP_001192973.1.25042 WP_001192973.1.25050 WP_001192973.1.25086 WP_001192973.1.25087 WP_001192973.1.25126 WP_001192973.1.25183 WP_001192973.1.25193 WP_001192973.1.25204 WP_001192973.1.25272 WP_001192973.1.2531 WP_001192973.1.25312 WP_001192973.1.25346 WP_001192973.1.2537 WP_001192973.1.255 WP_001192973.1.25517 WP_001192973.1.25525 WP_001192973.1.2558 WP_001192973.1.25602 WP_001192973.1.25631 WP_001192973.1.25643 WP_001192973.1.25652 WP_001192973.1.25681 WP_001192973.1.25713 WP_001192973.1.25832 WP_001192973.1.25843 WP_001192973.1.25855 WP_001192973.1.2588 WP_001192973.1.25890 WP_001192973.1.25945 WP_001192973.1.25996 WP_001192973.1.26048 WP_001192973.1.26100 WP_001192973.1.2612 WP_001192973.1.26130 WP_001192973.1.26150 WP_001192973.1.26161 WP_001192973.1.26191 WP_001192973.1.26262 WP_001192973.1.26264 WP_001192973.1.26270 WP_001192973.1.26325 WP_001192973.1.26331 WP_001192973.1.2637 WP_001192973.1.26379 WP_001192973.1.26391 WP_001192973.1.26401 WP_001192973.1.26403 WP_001192973.1.2642 WP_001192973.1.26438 WP_001192973.1.26443 WP_001192973.1.26467 WP_001192973.1.26479 WP_001192973.1.26480 WP_001192973.1.26517 WP_001192973.1.26569 WP_001192973.1.26575 WP_001192973.1.26588 WP_001192973.1.26590 WP_001192973.1.26598 WP_001192973.1.26609 WP_001192973.1.26613 WP_001192973.1.26644 WP_001192973.1.26658 WP_001192973.1.26683 WP_001192973.1.26716 WP_001192973.1.26720 WP_001192973.1.26839 WP_001192973.1.26912 WP_001192973.1.2694 WP_001192973.1.26941 WP_001192973.1.26943 WP_001192973.1.27060 WP_001192973.1.27098 WP_001192973.1.2712 WP_001192973.1.27134 WP_001192973.1.27141 WP_001192973.1.27175 WP_001192973.1.27214 WP_001192973.1.27260 WP_001192973.1.27280 WP_001192973.1.27283 WP_001192973.1.27292 WP_001192973.1.27310 WP_001192973.1.27330 WP_001192973.1.27367 WP_001192973.1.27396 WP_001192973.1.27451 WP_001192973.1.27504 WP_001192973.1.27518 WP_001192973.1.2755 WP_001192973.1.27560 WP_001192973.1.27580 WP_001192973.1.27585 WP_001192973.1.27611 WP_001192973.1.27691 WP_001192973.1.27693 WP_001192973.1.27698 WP_001192973.1.27734 WP_001192973.1.27741 WP_001192973.1.27742 WP_001192973.1.27749 WP_001192973.1.27758 WP_001192973.1.27774 WP_001192973.1.2782 WP_001192973.1.27856 WP_001192973.1.27876 WP_001192973.1.27879 WP_001192973.1.27923 WP_001192973.1.28102 WP_001192973.1.28109 WP_001192973.1.2811 WP_001192973.1.28110 WP_001192973.1.28128 WP_001192973.1.28184 WP_001192973.1.28250 WP_001192973.1.2826 WP_001192973.1.28271 WP_001192973.1.28305 WP_001192973.1.28318 WP_001192973.1.28322 WP_001192973.1.28401 WP_001192973.1.28414 WP_001192973.1.28440 WP_001192973.1.28480 WP_001192973.1.28496 WP_001192973.1.28509 WP_001192973.1.28523 WP_001192973.1.28540 WP_001192973.1.28544 WP_001192973.1.28639 WP_001192973.1.28662 WP_001192973.1.28683 WP_001192973.1.28697 WP_001192973.1.28711 WP_001192973.1.28760 WP_001192973.1.28762 WP_001192973.1.28769 WP_001192973.1.28809 WP_001192973.1.28835 WP_001192973.1.28863 WP_001192973.1.28919 WP_001192973.1.28950 WP_001192973.1.28953 WP_001192973.1.28982 WP_001192973.1.28994 WP_001192973.1.290 WP_001192973.1.29001 WP_001192973.1.29013 WP_001192973.1.29016 WP_001192973.1.29026 WP_001192973.1.29049 WP_001192973.1.29061 WP_001192973.1.29079 WP_001192973.1.29100 WP_001192973.1.29118 WP_001192973.1.29125 WP_001192973.1.29128 WP_001192973.1.29150 WP_001192973.1.29176 WP_001192973.1.29194 WP_001192973.1.29206 WP_001192973.1.29239 WP_001192973.1.29252 WP_001192973.1.2926 WP_001192973.1.29341 WP_001192973.1.29394 WP_001192973.1.2942 WP_001192973.1.29429 WP_001192973.1.29486 WP_001192973.1.29495 WP_001192973.1.29497 WP_001192973.1.29503 WP_001192973.1.2952 WP_001192973.1.29643 WP_001192973.1.29683 WP_001192973.1.29689 WP_001192973.1.29715 WP_001192973.1.29724 WP_001192973.1.29746 WP_001192973.1.29752 WP_001192973.1.29812 WP_001192973.1.29821 WP_001192973.1.29874 WP_001192973.1.29884 WP_001192973.1.2995 WP_001192973.1.29967 WP_001192973.1.29992 WP_001192973.1.30004 WP_001192973.1.30098 WP_001192973.1.30123 WP_001192973.1.30221 WP_001192973.1.30231 WP_001192973.1.30247 WP_001192973.1.30253 WP_001192973.1.30391 WP_001192973.1.30428 WP_001192973.1.3045 WP_001192973.1.30452 WP_001192973.1.30479 WP_001192973.1.30497 WP_001192973.1.30554 WP_001192973.1.30580 WP_001192973.1.306 WP_001192973.1.3063 WP_001192973.1.30733 WP_001192973.1.30742 WP_001192973.1.30749 WP_001192973.1.30762 WP_001192973.1.30783 WP_001192973.1.30808 WP_001192973.1.30843 WP_001192973.1.30853 WP_001192973.1.30866 WP_001192973.1.31000 WP_001192973.1.31009 WP_001192973.1.31083 WP_001192973.1.31089 WP_001192973.1.31142 WP_001192973.1.31149 WP_001192973.1.31154 WP_001192973.1.31188 WP_001192973.1.31211 WP_001192973.1.31295 WP_001192973.1.31379 WP_001192973.1.31407 WP_001192973.1.31419 WP_001192973.1.31421 WP_001192973.1.31431 WP_001192973.1.31506 WP_001192973.1.31509 WP_001192973.1.31521 WP_001192973.1.31527 WP_001192973.1.31542 WP_001192973.1.31614 WP_001192973.1.31639 WP_001192973.1.31679 WP_001192973.1.3169 WP_001192973.1.31709 WP_001192973.1.31740 WP_001192973.1.31809 WP_001192973.1.3181 WP_001192973.1.31833 WP_001192973.1.31835 WP_001192973.1.31839 WP_001192973.1.31898 WP_001192973.1.31928 WP_001192973.1.3193 WP_001192973.1.31978 WP_001192973.1.32020 WP_001192973.1.3203 WP_001192973.1.32037 WP_001192973.1.32089 WP_001192973.1.32091 WP_001192973.1.32093 WP_001192973.1.3212 WP_001192973.1.32121 WP_001192973.1.32127 WP_001192973.1.32138 WP_001192973.1.3215 WP_001192973.1.32173 WP_001192973.1.32232 WP_001192973.1.32234 WP_001192973.1.32236 WP_001192973.1.32279 WP_001192973.1.3233 WP_001192973.1.32333 WP_001192973.1.32394 WP_001192973.1.32479 WP_001192973.1.3248 WP_001192973.1.32480 WP_001192973.1.32494 WP_001192973.1.32558 WP_001192973.1.32561 WP_001192973.1.32580 WP_001192973.1.32587 WP_001192973.1.32591 WP_001192973.1.32635 WP_001192973.1.32655 WP_001192973.1.32676 WP_001192973.1.32680 WP_001192973.1.32720 WP_001192973.1.32722 WP_001192973.1.32724 WP_001192973.1.32772 WP_001192973.1.32811 WP_001192973.1.32815 WP_001192973.1.32835 WP_001192973.1.32875 WP_001192973.1.32903 WP_001192973.1.32910 WP_001192973.1.32946 WP_001192973.1.3295 WP_001192973.1.32959 WP_001192973.1.32972 WP_001192973.1.32984 WP_001192973.1.32992 WP_001192973.1.33004 WP_001192973.1.33014 WP_001192973.1.33022 WP_001192973.1.33026 WP_001192973.1.33053 WP_001192973.1.33101 WP_001192973.1.33119 WP_001192973.1.33171 WP_001192973.1.33222 WP_001192973.1.3323 WP_001192973.1.33237 WP_001192973.1.33325 WP_001192973.1.33341 WP_001192973.1.33369 WP_001192973.1.33385 WP_001192973.1.33408 WP_001192973.1.33422 WP_001192973.1.33424 WP_001192973.1.33476 WP_001192973.1.33502 WP_001192973.1.33512 WP_001192973.1.33545 WP_001192973.1.33565 WP_001192973.1.33595 WP_001192973.1.33631 WP_001192973.1.33638 WP_001192973.1.33667 WP_001192973.1.33736 WP_001192973.1.33745 WP_001192973.1.33746 WP_001192973.1.33751 WP_001192973.1.33799 WP_001192973.1.33823 WP_001192973.1.33853 WP_001192973.1.33854 WP_001192973.1.33879 WP_001192973.1.33888 WP_001192973.1.33896 WP_001192973.1.33948 WP_001192973.1.33974 WP_001192973.1.33979 WP_001192973.1.3398 WP_001192973.1.3401 WP_001192973.1.34032 WP_001192973.1.34094 WP_001192973.1.3411 WP_001192973.1.34122 WP_001192973.1.34124 WP_001192973.1.34144 WP_001192973.1.3415 WP_001192973.1.342 WP_001192973.1.34204 WP_001192973.1.34270 WP_001192973.1.34273 WP_001192973.1.34341 WP_001192973.1.34348 WP_001192973.1.34363 WP_001192973.1.3439 WP_001192973.1.34397 WP_001192973.1.34400 WP_001192973.1.3444 WP_001192973.1.34440 WP_001192973.1.34441 WP_001192973.1.34444 WP_001192973.1.34464 WP_001192973.1.34470 WP_001192973.1.34525 WP_001192973.1.34532 WP_001192973.1.34538 WP_001192973.1.34558 WP_001192973.1.34605 WP_001192973.1.34675 WP_001192973.1.34682 WP_001192973.1.347 WP_001192973.1.3472 WP_001192973.1.34727 WP_001192973.1.34782 WP_001192973.1.34794 WP_001192973.1.34827 WP_001192973.1.34838 WP_001192973.1.34855 WP_001192973.1.34948 WP_001192973.1.34966 WP_001192973.1.34982 WP_001192973.1.34983 WP_001192973.1.34990 WP_001192973.1.34993 WP_001192973.1.35003 WP_001192973.1.35114 WP_001192973.1.35132 WP_001192973.1.3515 WP_001192973.1.35168 WP_001192973.1.35180 WP_001192973.1.35186 WP_001192973.1.35195 WP_001192973.1.35202 WP_001192973.1.3521 WP_001192973.1.35349 WP_001192973.1.35360 WP_001192973.1.35398 WP_001192973.1.35448 WP_001192973.1.35465 WP_001192973.1.35466 WP_001192973.1.35468 WP_001192973.1.35552 WP_001192973.1.35581 WP_001192973.1.3560 WP_001192973.1.35604 WP_001192973.1.35651 WP_001192973.1.35704 WP_001192973.1.35724 WP_001192973.1.35740 WP_001192973.1.35942 WP_001192973.1.35959 WP_001192973.1.35990 WP_001192973.1.36040 WP_001192973.1.36042 WP_001192973.1.36071 WP_001192973.1.36085 WP_001192973.1.36094 WP_001192973.1.36105 WP_001192973.1.36164 WP_001192973.1.36182 WP_001192973.1.3620 WP_001192973.1.36207 WP_001192973.1.36281 WP_001192973.1.36332 WP_001192973.1.36352 WP_001192973.1.36386 WP_001192973.1.36393 WP_001192973.1.36412 WP_001192973.1.36426 WP_001192973.1.36453 WP_001192973.1.36496 WP_001192973.1.36507 WP_001192973.1.36523 WP_001192973.1.36531 WP_001192973.1.36627 WP_001192973.1.36628 WP_001192973.1.3668 WP_001192973.1.36707 WP_001192973.1.3671 WP_001192973.1.36739 WP_001192973.1.36746 WP_001192973.1.36747 WP_001192973.1.36806 WP_001192973.1.36812 WP_001192973.1.36817 WP_001192973.1.36826 WP_001192973.1.36886 WP_001192973.1.36904 WP_001192973.1.36925 WP_001192973.1.36971 WP_001192973.1.36975 WP_001192973.1.37006 WP_001192973.1.37020 WP_001192973.1.37049 WP_001192973.1.37099 WP_001192973.1.37122 WP_001192973.1.37146 WP_001192973.1.37153 WP_001192973.1.3723 WP_001192973.1.37233 WP_001192973.1.37252 WP_001192973.1.37261 WP_001192973.1.37329 WP_001192973.1.37334 WP_001192973.1.37352 WP_001192973.1.37360 WP_001192973.1.37371 WP_001192973.1.37419 WP_001192973.1.37445 WP_001192973.1.37472 WP_001192973.1.37476 WP_001192973.1.37485 WP_001192973.1.3749 WP_001192973.1.37516 WP_001192973.1.37538 WP_001192973.1.37548 WP_001192973.1.37554 WP_001192973.1.37576 WP_001192973.1.37588 WP_001192973.1.37634 WP_001192973.1.37745 WP_001192973.1.37750 WP_001192973.1.37758 WP_001192973.1.37762 WP_001192973.1.37766 WP_001192973.1.37847 WP_001192973.1.37852 WP_001192973.1.3788 WP_001192973.1.37880 WP_001192973.1.37897 WP_001192973.1.37923 WP_001192973.1.37926 WP_001192973.1.37940 WP_001192973.1.37964 WP_001192973.1.38043 WP_001192973.1.38080 WP_001192973.1.38081 WP_001192973.1.38085 WP_001192973.1.38105 WP_001192973.1.3811 WP_001192973.1.38155 WP_001192973.1.38182 WP_001192973.1.38211 WP_001192973.1.3822 WP_001192973.1.38234 WP_001192973.1.38264 WP_001192973.1.38314 WP_001192973.1.38357 WP_001192973.1.38363 WP_001192973.1.38392 WP_001192973.1.38419 WP_001192973.1.38485 WP_001192973.1.38533 WP_001192973.1.38544 WP_001192973.1.38584 WP_001192973.1.38629 WP_001192973.1.38636 WP_001192973.1.38694 WP_001192973.1.38722 WP_001192973.1.3873 WP_001192973.1.38751 WP_001192973.1.38777 WP_001192973.1.38782 WP_001192973.1.38811 WP_001192973.1.38827 WP_001192973.1.38843 WP_001192973.1.38896 WP_001192973.1.38911 WP_001192973.1.38920 WP_001192973.1.38950 WP_001192973.1.38956 WP_001192973.1.39037 WP_001192973.1.3904 WP_001192973.1.39042 WP_001192973.1.39148 WP_001192973.1.39150 WP_001192973.1.39155 WP_001192973.1.39164 WP_001192973.1.39167 WP_001192973.1.39171 WP_001192973.1.39184 WP_001192973.1.39196 WP_001192973.1.3921 WP_001192973.1.3922 WP_001192973.1.39249 WP_001192973.1.39254 WP_001192973.1.39302 WP_001192973.1.39342 WP_001192973.1.39356 WP_001192973.1.39365 WP_001192973.1.39367 WP_001192973.1.39402 WP_001192973.1.39430 WP_001192973.1.39481 WP_001192973.1.39492 WP_001192973.1.39509 WP_001192973.1.39531 WP_001192973.1.3954 WP_001192973.1.39541 WP_001192973.1.39575 WP_001192973.1.39594 WP_001192973.1.39606 WP_001192973.1.39607 WP_001192973.1.39610 WP_001192973.1.39626 WP_001192973.1.39636 WP_001192973.1.39690 WP_001192973.1.39715 WP_001192973.1.39796 WP_001192973.1.3980 WP_001192973.1.39822 WP_001192973.1.39829 WP_001192973.1.39870 WP_001192973.1.39938 WP_001192973.1.39973 WP_001192973.1.39992 WP_001192973.1.40013 WP_001192973.1.40016 WP_001192973.1.4005 WP_001192973.1.40088 WP_001192973.1.40140 WP_001192973.1.40147 WP_001192973.1.40192 WP_001192973.1.4020 WP_001192973.1.40218 WP_001192973.1.40238 WP_001192973.1.40298 WP_001192973.1.40315 WP_001192973.1.40317 WP_001192973.1.40319 WP_001192973.1.40335 WP_001192973.1.40389 WP_001192973.1.40445 WP_001192973.1.40499 WP_001192973.1.40502 WP_001192973.1.40509 WP_001192973.1.40524 WP_001192973.1.40548 WP_001192973.1.40563 WP_001192973.1.40596 WP_001192973.1.40599 WP_001192973.1.40617 WP_001192973.1.40666 WP_001192973.1.40686 WP_001192973.1.40813 WP_001192973.1.40815 WP_001192973.1.4082 WP_001192973.1.40833 WP_001192973.1.40865 WP_001192973.1.40893 WP_001192973.1.40898 WP_001192973.1.40912 WP_001192973.1.40965 WP_001192973.1.41037 WP_001192973.1.41045 WP_001192973.1.41147 WP_001192973.1.41206 WP_001192973.1.41239 WP_001192973.1.4126 WP_001192973.1.41263 WP_001192973.1.41315 WP_001192973.1.41346 WP_001192973.1.41368 WP_001192973.1.41371 WP_001192973.1.41394 WP_001192973.1.41401 WP_001192973.1.41402 WP_001192973.1.41417 WP_001192973.1.41436 WP_001192973.1.41457 WP_001192973.1.41479 WP_001192973.1.41483 WP_001192973.1.41484 WP_001192973.1.41488 WP_001192973.1.41530 WP_001192973.1.41539 WP_001192973.1.41545 WP_001192973.1.41556 WP_001192973.1.41566 WP_001192973.1.4158 WP_001192973.1.41621 WP_001192973.1.41651 WP_001192973.1.41654 WP_001192973.1.41740 WP_001192973.1.41752 WP_001192973.1.41780 WP_001192973.1.41784 WP_001192973.1.41809 WP_001192973.1.41812 WP_001192973.1.41837 WP_001192973.1.41900 WP_001192973.1.4193 WP_001192973.1.41960 WP_001192973.1.41964 WP_001192973.1.41991 WP_001192973.1.42022 WP_001192973.1.42027 WP_001192973.1.42033 WP_001192973.1.42073 WP_001192973.1.42095 WP_001192973.1.42113 WP_001192973.1.4214 WP_001192973.1.42151 WP_001192973.1.42159 WP_001192973.1.42179 WP_001192973.1.42209 WP_001192973.1.42221 WP_001192973.1.42226 WP_001192973.1.4224 WP_001192973.1.42318 WP_001192973.1.42359 WP_001192973.1.42367 WP_001192973.1.42369 WP_001192973.1.42376 WP_001192973.1.42415 WP_001192973.1.4242 WP_001192973.1.42432 WP_001192973.1.42443 WP_001192973.1.42456 WP_001192973.1.42522 WP_001192973.1.42547 WP_001192973.1.42632 WP_001192973.1.42661 WP_001192973.1.42728 WP_001192973.1.42749 WP_001192973.1.42770 WP_001192973.1.42771 WP_001192973.1.42791 WP_001192973.1.42808 WP_001192973.1.42813 WP_001192973.1.4282 WP_001192973.1.42879 WP_001192973.1.42880 WP_001192973.1.42891 WP_001192973.1.4290 WP_001192973.1.42918 WP_001192973.1.42936 WP_001192973.1.42937 WP_001192973.1.42950 WP_001192973.1.42966 WP_001192973.1.42987 WP_001192973.1.42989 WP_001192973.1.4306 WP_001192973.1.43123 WP_001192973.1.43137 WP_001192973.1.43174 WP_001192973.1.43177 WP_001192973.1.43213 WP_001192973.1.43239 WP_001192973.1.4334 WP_001192973.1.43389 WP_001192973.1.43444 WP_001192973.1.43455 WP_001192973.1.43474 WP_001192973.1.43489 WP_001192973.1.43598 WP_001192973.1.436 WP_001192973.1.43604 WP_001192973.1.43622 WP_001192973.1.43720 WP_001192973.1.43738 WP_001192973.1.43750 WP_001192973.1.43769 WP_001192973.1.43804 WP_001192973.1.43858 WP_001192973.1.43898 WP_001192973.1.43925 WP_001192973.1.43966 WP_001192973.1.43989 WP_001192973.1.44020 WP_001192973.1.44029 WP_001192973.1.44075 WP_001192973.1.44096 WP_001192973.1.4411 WP_001192973.1.44115 WP_001192973.1.44130 WP_001192973.1.44162 WP_001192973.1.44166 WP_001192973.1.44201 WP_001192973.1.44211 WP_001192973.1.44238 WP_001192973.1.44264 WP_001192973.1.44273 WP_001192973.1.44287 WP_001192973.1.44292 WP_001192973.1.44365 WP_001192973.1.44461 WP_001192973.1.4449 WP_001192973.1.44524 WP_001192973.1.4454 WP_001192973.1.44570 WP_001192973.1.44587 WP_001192973.1.44608 WP_001192973.1.44642 WP_001192973.1.44649 WP_001192973.1.44661 WP_001192973.1.44668 WP_001192973.1.4471 WP_001192973.1.44724 WP_001192973.1.44756 WP_001192973.1.44821 WP_001192973.1.44841 WP_001192973.1.44849 WP_001192973.1.44854 WP_001192973.1.44970 WP_001192973.1.44975 WP_001192973.1.45025 WP_001192973.1.45028 WP_001192973.1.45043 WP_001192973.1.45053 WP_001192973.1.45116 WP_001192973.1.4516 WP_001192973.1.45208 WP_001192973.1.4524 WP_001192973.1.45246 WP_001192973.1.45301 WP_001192973.1.45313 WP_001192973.1.45359 WP_001192973.1.4538 WP_001192973.1.45440 WP_001192973.1.45444 WP_001192973.1.45486 WP_001192973.1.4549 WP_001192973.1.45565 WP_001192973.1.45581 WP_001192973.1.45595 WP_001192973.1.4563 WP_001192973.1.45664 WP_001192973.1.4570 WP_001192973.1.45718 WP_001192973.1.4574 WP_001192973.1.45740 WP_001192973.1.45752 WP_001192973.1.45840 WP_001192973.1.45931 WP_001192973.1.45933 WP_001192973.1.4600 WP_001192973.1.46048 WP_001192973.1.46049 WP_001192973.1.46070 WP_001192973.1.46081 WP_001192973.1.46097 WP_001192973.1.46115 WP_001192973.1.4613 WP_001192973.1.4617 WP_001192973.1.46186 WP_001192973.1.46213 WP_001192973.1.46239 WP_001192973.1.46257 WP_001192973.1.46301 WP_001192973.1.46329 WP_001192973.1.46379 WP_001192973.1.4643 WP_001192973.1.4646 WP_001192973.1.4647 WP_001192973.1.46477 WP_001192973.1.46526 WP_001192973.1.46531 WP_001192973.1.46552 WP_001192973.1.4657 WP_001192973.1.46573 WP_001192973.1.46582 WP_001192973.1.46594 WP_001192973.1.46602 WP_001192973.1.46614 WP_001192973.1.46616 WP_001192973.1.46643 WP_001192973.1.4670 WP_001192973.1.46734 WP_001192973.1.46743 WP_001192973.1.46802 WP_001192973.1.46876 WP_001192973.1.46882 WP_001192973.1.46898 WP_001192973.1.4691 WP_001192973.1.46912 WP_001192973.1.46999 WP_001192973.1.47028 WP_001192973.1.47029 WP_001192973.1.47030 WP_001192973.1.47038 WP_001192973.1.47048 WP_001192973.1.47050 WP_001192973.1.47063 WP_001192973.1.47069 WP_001192973.1.47073 WP_001192973.1.47156 WP_001192973.1.47167 WP_001192973.1.47186 WP_001192973.1.47197 WP_001192973.1.47280 WP_001192973.1.47307 WP_001192973.1.47316 WP_001192973.1.47319 WP_001192973.1.47322 WP_001192973.1.47332 WP_001192973.1.47356 WP_001192973.1.47363 WP_001192973.1.47370 WP_001192973.1.4740 WP_001192973.1.47401 WP_001192973.1.47414 WP_001192973.1.47425 WP_001192973.1.47477 WP_001192973.1.47496 WP_001192973.1.47500 WP_001192973.1.47529 WP_001192973.1.47546 WP_001192973.1.47555 WP_001192973.1.47582 WP_001192973.1.47634 WP_001192973.1.47646 WP_001192973.1.47654 WP_001192973.1.47673 WP_001192973.1.4772 WP_001192973.1.47740 WP_001192973.1.47744 WP_001192973.1.47761 WP_001192973.1.47764 WP_001192973.1.47765 WP_001192973.1.47770 WP_001192973.1.47790 WP_001192973.1.47848 WP_001192973.1.4785 WP_001192973.1.4796 WP_001192973.1.47962 WP_001192973.1.47983 WP_001192973.1.48000 WP_001192973.1.48018 WP_001192973.1.48029 WP_001192973.1.48040 WP_001192973.1.48048 WP_001192973.1.48073 WP_001192973.1.48080 WP_001192973.1.48090 WP_001192973.1.48096 WP_001192973.1.48111 WP_001192973.1.48168 WP_001192973.1.48188 WP_001192973.1.48200 WP_001192973.1.48203 WP_001192973.1.48216 WP_001192973.1.48222 WP_001192973.1.48229 WP_001192973.1.48285 WP_001192973.1.48290 WP_001192973.1.48291 WP_001192973.1.48355 WP_001192973.1.48371 WP_001192973.1.48385 WP_001192973.1.48417 WP_001192973.1.48421 WP_001192973.1.48477 WP_001192973.1.48480 WP_001192973.1.48483 WP_001192973.1.48505 WP_001192973.1.48522 WP_001192973.1.4857 WP_001192973.1.48602 WP_001192973.1.48678 WP_001192973.1.48689 WP_001192973.1.4871 WP_001192973.1.4876 WP_001192973.1.48771 WP_001192973.1.48847 WP_001192973.1.48860 WP_001192973.1.48901 WP_001192973.1.48907 WP_001192973.1.48910 WP_001192973.1.48926 WP_001192973.1.48928 WP_001192973.1.48953 WP_001192973.1.48970 WP_001192973.1.48974 WP_001192973.1.49009 WP_001192973.1.49124 WP_001192973.1.49136 WP_001192973.1.49147 WP_001192973.1.49190 WP_001192973.1.49236 WP_001192973.1.49243 WP_001192973.1.49259 WP_001192973.1.49275 WP_001192973.1.49312 WP_001192973.1.49321 WP_001192973.1.49363 WP_001192973.1.49459 WP_001192973.1.49482 WP_001192973.1.49531 WP_001192973.1.49537 WP_001192973.1.49558 WP_001192973.1.49599 WP_001192973.1.49621 WP_001192973.1.49645 WP_001192973.1.49661 WP_001192973.1.49684 WP_001192973.1.497 WP_001192973.1.49722 WP_001192973.1.49733 WP_001192973.1.49747 WP_001192973.1.49768 WP_001192973.1.49774 WP_001192973.1.49777 WP_001192973.1.49861 WP_001192973.1.49879 WP_001192973.1.49883 WP_001192973.1.49900 WP_001192973.1.49902 WP_001192973.1.49954 WP_001192973.1.49987 WP_001192973.1.50006 WP_001192973.1.50008 WP_001192973.1.50036 WP_001192973.1.50078 WP_001192973.1.50098 WP_001192973.1.50113 WP_001192973.1.5017 WP_001192973.1.50187 WP_001192973.1.50196 WP_001192973.1.50230 WP_001192973.1.50262 WP_001192973.1.50266 WP_001192973.1.50269 WP_001192973.1.50278 WP_001192973.1.50304 WP_001192973.1.50353 WP_001192973.1.50361 WP_001192973.1.50366 WP_001192973.1.50381 WP_001192973.1.5040 WP_001192973.1.5041 WP_001192973.1.50418 WP_001192973.1.50452 WP_001192973.1.5046 WP_001192973.1.50539 WP_001192973.1.50548 WP_001192973.1.5056 WP_001192973.1.50564 WP_001192973.1.50579 WP_001192973.1.50586 WP_001192973.1.50616 WP_001192973.1.5064 WP_001192973.1.5067 WP_001192973.1.50715 WP_001192973.1.50717 WP_001192973.1.50725 WP_001192973.1.50936 WP_001192973.1.50939 WP_001192973.1.5095 WP_001192973.1.50969 WP_001192973.1.50993 WP_001192973.1.51013 WP_001192973.1.51027 WP_001192973.1.51042 WP_001192973.1.51058 WP_001192973.1.5106 WP_001192973.1.51109 WP_001192973.1.51172 WP_001192973.1.51201 WP_001192973.1.51248 WP_001192973.1.51255 WP_001192973.1.5128 WP_001192973.1.51283 WP_001192973.1.51300 WP_001192973.1.51323 WP_001192973.1.51325 WP_001192973.1.51336 WP_001192973.1.51360 WP_001192973.1.51380 WP_001192973.1.51425 WP_001192973.1.51430 WP_001192973.1.51441 WP_001192973.1.5146 WP_001192973.1.51462 WP_001192973.1.51495 WP_001192973.1.51525 WP_001192973.1.51539 WP_001192973.1.51548 WP_001192973.1.51552 WP_001192973.1.5157 WP_001192973.1.51580 WP_001192973.1.51587 WP_001192973.1.51607 WP_001192973.1.51629 WP_001192973.1.51707 WP_001192973.1.51718 WP_001192973.1.5172 WP_001192973.1.51760 WP_001192973.1.51784 WP_001192973.1.51837 WP_001192973.1.51873 WP_001192973.1.51899 WP_001192973.1.51949 WP_001192973.1.51968 WP_001192973.1.51979 WP_001192973.1.51988 WP_001192973.1.51999 WP_001192973.1.52011 WP_001192973.1.52020 WP_001192973.1.52062 WP_001192973.1.52076 WP_001192973.1.52111 WP_001192973.1.52126 WP_001192973.1.52127 WP_001192973.1.52186 WP_001192973.1.52200 WP_001192973.1.52213 WP_001192973.1.52214 WP_001192973.1.52230 WP_001192973.1.52236 WP_001192973.1.52240 WP_001192973.1.52243 WP_001192973.1.52249 WP_001192973.1.52257 WP_001192973.1.5227 WP_001192973.1.52305 WP_001192973.1.52313 WP_001192973.1.52333 WP_001192973.1.52378 WP_001192973.1.5239 WP_001192973.1.52413 WP_001192973.1.52419 WP_001192973.1.52421 WP_001192973.1.52492 WP_001192973.1.52524 WP_001192973.1.52544 WP_001192973.1.52558 WP_001192973.1.52568 WP_001192973.1.52601 WP_001192973.1.52612 WP_001192973.1.5265 WP_001192973.1.52691 WP_001192973.1.5272 WP_001192973.1.52762 WP_001192973.1.52774 WP_001192973.1.52780 WP_001192973.1.52781 WP_001192973.1.52801 WP_001192973.1.52844 WP_001192973.1.52846 WP_001192973.1.52852 WP_001192973.1.52853 WP_001192973.1.52881 WP_001192973.1.52895 WP_001192973.1.52908 WP_001192973.1.52913 WP_001192973.1.52962 WP_001192973.1.52995 WP_001192973.1.53012 WP_001192973.1.53020 WP_001192973.1.53027 WP_001192973.1.53110 WP_001192973.1.53155 WP_001192973.1.532 WP_001192973.1.5322 WP_001192973.1.53223 WP_001192973.1.53228 WP_001192973.1.53238 WP_001192973.1.53242 WP_001192973.1.53244 WP_001192973.1.53262 WP_001192973.1.53277 WP_001192973.1.53308 WP_001192973.1.53327 WP_001192973.1.53356 WP_001192973.1.53360 WP_001192973.1.53364 WP_001192973.1.53377 WP_001192973.1.53419 WP_001192973.1.5342 WP_001192973.1.53431 WP_001192973.1.53482 WP_001192973.1.53505 WP_001192973.1.53545 WP_001192973.1.53589 WP_001192973.1.53590 WP_001192973.1.53594 WP_001192973.1.53645 WP_001192973.1.53706 WP_001192973.1.53809 WP_001192973.1.53810 WP_001192973.1.53811 WP_001192973.1.53841 WP_001192973.1.53863 WP_001192973.1.53878 WP_001192973.1.53884 WP_001192973.1.5393 WP_001192973.1.53966 WP_001192973.1.53972 WP_001192973.1.53978 WP_001192973.1.53991 WP_001192973.1.54002 WP_001192973.1.54013 WP_001192973.1.54023 WP_001192973.1.54028 WP_001192973.1.54104 WP_001192973.1.54144 WP_001192973.1.54169 WP_001192973.1.54185 WP_001192973.1.54202 WP_001192973.1.54317 WP_001192973.1.54328 WP_001192973.1.54329 WP_001192973.1.5433 WP_001192973.1.54359 WP_001192973.1.54411 WP_001192973.1.54463 WP_001192973.1.54476 WP_001192973.1.54507 WP_001192973.1.54546 WP_001192973.1.5460 WP_001192973.1.54601 WP_001192973.1.54602 WP_001192973.1.54605 WP_001192973.1.5461 WP_001192973.1.54614 WP_001192973.1.54617 WP_001192973.1.54620 WP_001192973.1.54625 WP_001192973.1.54643 WP_001192973.1.54760 WP_001192973.1.5479 WP_001192973.1.54817 WP_001192973.1.54918 WP_001192973.1.54927 WP_001192973.1.54941 WP_001192973.1.54946 WP_001192973.1.54972 WP_001192973.1.54981 WP_001192973.1.54991 WP_001192973.1.55005 WP_001192973.1.55009 WP_001192973.1.55041 WP_001192973.1.55112 WP_001192973.1.5512 WP_001192973.1.55134 WP_001192973.1.55177 WP_001192973.1.55197 WP_001192973.1.55222 WP_001192973.1.55226 WP_001192973.1.55275 WP_001192973.1.55291 WP_001192973.1.55342 WP_001192973.1.55359 WP_001192973.1.55374 WP_001192973.1.55381 WP_001192973.1.55417 WP_001192973.1.55424 WP_001192973.1.55425 WP_001192973.1.55466 WP_001192973.1.55489 WP_001192973.1.55507 WP_001192973.1.55529 WP_001192973.1.55552 WP_001192973.1.55560 WP_001192973.1.55574 WP_001192973.1.55581 WP_001192973.1.55597 WP_001192973.1.55608 WP_001192973.1.5561 WP_001192973.1.55629 WP_001192973.1.55676 WP_001192973.1.5570 WP_001192973.1.55709 WP_001192973.1.55720 WP_001192973.1.55730 WP_001192973.1.55757 WP_001192973.1.55787 WP_001192973.1.55791 WP_001192973.1.55825 WP_001192973.1.55868 WP_001192973.1.561 WP_001192973.1.5614 WP_001192973.1.56149 WP_001192973.1.56151 WP_001192973.1.56164 WP_001192973.1.56169 WP_001192973.1.56177 WP_001192973.1.56197 WP_001192973.1.56285 WP_001192973.1.56293 WP_001192973.1.56302 WP_001192973.1.56371 WP_001192973.1.56388 WP_001192973.1.56390 WP_001192973.1.56436 WP_001192973.1.56446 WP_001192973.1.5649 WP_001192973.1.56501 WP_001192973.1.56513 WP_001192973.1.56528 WP_001192973.1.56573 WP_001192973.1.56586 WP_001192973.1.56665 WP_001192973.1.56689 WP_001192973.1.56713 WP_001192973.1.56742 WP_001192973.1.56776 WP_001192973.1.56777 WP_001192973.1.56786 WP_001192973.1.56787 WP_001192973.1.56789 WP_001192973.1.56799 WP_001192973.1.56830 WP_001192973.1.56871 WP_001192973.1.56882 WP_001192973.1.56932 WP_001192973.1.56934 WP_001192973.1.56937 WP_001192973.1.56951 WP_001192973.1.56980 WP_001192973.1.57072 WP_001192973.1.57086 WP_001192973.1.57100 WP_001192973.1.57124 WP_001192973.1.57181 WP_001192973.1.57182 WP_001192973.1.57185 WP_001192973.1.57216 WP_001192973.1.57222 WP_001192973.1.57254 WP_001192973.1.57269 WP_001192973.1.57281 WP_001192973.1.57386 WP_001192973.1.57401 WP_001192973.1.57403 WP_001192973.1.57410 WP_001192973.1.57414 WP_001192973.1.57432 WP_001192973.1.57438 WP_001192973.1.57517 WP_001192973.1.57538 WP_001192973.1.5755 WP_001192973.1.57558 WP_001192973.1.57588 WP_001192973.1.57629 WP_001192973.1.57638 WP_001192973.1.57659 WP_001192973.1.57663 WP_001192973.1.57669 WP_001192973.1.57719 WP_001192973.1.57738 WP_001192973.1.57846 WP_001192973.1.5786 WP_001192973.1.57898 WP_001192973.1.57904 WP_001192973.1.57982 WP_001192973.1.57983 WP_001192973.1.57994 WP_001192973.1.58045 WP_001192973.1.58060 WP_001192973.1.58080 WP_001192973.1.58098 WP_001192973.1.5810 WP_001192973.1.58128 WP_001192973.1.58143 WP_001192973.1.58146 WP_001192973.1.58163 WP_001192973.1.58206 WP_001192973.1.58226 WP_001192973.1.58232 WP_001192973.1.58244 WP_001192973.1.58267 WP_001192973.1.58336 WP_001192973.1.58340 WP_001192973.1.58371 WP_001192973.1.58384 WP_001192973.1.58401 WP_001192973.1.58408 WP_001192973.1.5842 WP_001192973.1.58420 WP_001192973.1.58429 WP_001192973.1.58440 WP_001192973.1.58444 WP_001192973.1.58445 WP_001192973.1.58475 WP_001192973.1.58493 WP_001192973.1.58496 WP_001192973.1.58507 WP_001192973.1.58514 WP_001192973.1.58528 WP_001192973.1.58547 WP_001192973.1.58560 WP_001192973.1.58572 WP_001192973.1.58582 WP_001192973.1.58622 WP_001192973.1.58705 WP_001192973.1.58799 WP_001192973.1.58837 WP_001192973.1.58867 WP_001192973.1.58870 WP_001192973.1.58901 WP_001192973.1.58940 WP_001192973.1.58942 WP_001192973.1.58976 WP_001192973.1.58999 WP_001192973.1.59024 WP_001192973.1.59026 WP_001192973.1.59047 WP_001192973.1.5906 WP_001192973.1.59083 WP_001192973.1.59174 WP_001192973.1.59263 WP_001192973.1.59280 WP_001192973.1.59293 WP_001192973.1.59306 WP_001192973.1.59395 WP_001192973.1.59396 WP_001192973.1.59407 WP_001192973.1.59409 WP_001192973.1.59413 WP_001192973.1.59423 WP_001192973.1.59434 WP_001192973.1.59513 WP_001192973.1.59533 WP_001192973.1.59553 WP_001192973.1.59590 WP_001192973.1.59615 WP_001192973.1.59621 WP_001192973.1.5963 WP_001192973.1.59638 WP_001192973.1.5965 WP_001192973.1.59689 WP_001192973.1.59699 WP_001192973.1.59730 WP_001192973.1.59737 WP_001192973.1.59748 WP_001192973.1.59756 WP_001192973.1.59781 WP_001192973.1.59791 WP_001192973.1.59793 WP_001192973.1.59823 WP_001192973.1.59836 WP_001192973.1.59853 WP_001192973.1.59855 WP_001192973.1.59858 WP_001192973.1.59877 WP_001192973.1.59912 WP_001192973.1.59932 WP_001192973.1.59989 WP_001192973.1.60005 WP_001192973.1.6002 WP_001192973.1.60023 WP_001192973.1.60048 WP_001192973.1.60067 WP_001192973.1.60095 WP_001192973.1.6013 WP_001192973.1.60151 WP_001192973.1.6022 WP_001192973.1.60225 WP_001192973.1.60228 WP_001192973.1.60325 WP_001192973.1.60337 WP_001192973.1.60343 WP_001192973.1.60387 WP_001192973.1.60436 WP_001192973.1.60457 WP_001192973.1.60477 WP_001192973.1.60491 WP_001192973.1.60505 WP_001192973.1.60550 WP_001192973.1.60559 WP_001192973.1.60567 WP_001192973.1.6061 WP_001192973.1.6064 WP_001192973.1.6066 WP_001192973.1.6068 WP_001192973.1.60717 WP_001192973.1.60732 WP_001192973.1.60805 WP_001192973.1.60816 WP_001192973.1.60832 WP_001192973.1.60847 WP_001192973.1.60901 WP_001192973.1.60925 WP_001192973.1.60927 WP_001192973.1.6094 WP_001192973.1.60974 WP_001192973.1.61005 WP_001192973.1.61006 WP_001192973.1.61008 WP_001192973.1.61035 WP_001192973.1.61046 WP_001192973.1.61058 WP_001192973.1.61096 WP_001192973.1.61097 WP_001192973.1.61102 WP_001192973.1.61132 WP_001192973.1.61174 WP_001192973.1.61175 WP_001192973.1.61181 WP_001192973.1.61183 WP_001192973.1.61223 WP_001192973.1.61225 WP_001192973.1.61284 WP_001192973.1.61292 WP_001192973.1.61360 WP_001192973.1.61364 WP_001192973.1.61398 WP_001192973.1.61505 WP_001192973.1.61517 WP_001192973.1.61524 WP_001192973.1.61551 WP_001192973.1.61608 WP_001192973.1.61636 WP_001192973.1.61718 WP_001192973.1.61758 WP_001192973.1.61770 WP_001192973.1.61779 WP_001192973.1.61806 WP_001192973.1.61822 WP_001192973.1.61853 WP_001192973.1.61949 WP_001192973.1.61955 WP_001192973.1.61985 WP_001192973.1.6212 WP_001192973.1.62157 WP_001192973.1.62207 WP_001192973.1.62264 WP_001192973.1.62273 WP_001192973.1.62290 WP_001192973.1.62337 WP_001192973.1.62348 WP_001192973.1.62358 WP_001192973.1.62424 WP_001192973.1.62460 WP_001192973.1.62487 WP_001192973.1.62503 WP_001192973.1.62541 WP_001192973.1.62612 WP_001192973.1.62631 WP_001192973.1.62646 WP_001192973.1.62668 WP_001192973.1.62681 WP_001192973.1.62714 WP_001192973.1.62735 WP_001192973.1.62750 WP_001192973.1.62762 WP_001192973.1.62769 WP_001192973.1.62787 WP_001192973.1.62812 WP_001192973.1.62818 WP_001192973.1.62843 WP_001192973.1.62919 WP_001192973.1.6293 WP_001192973.1.62931 WP_001192973.1.62959 WP_001192973.1.62989 WP_001192973.1.62992 WP_001192973.1.6307 WP_001192973.1.63078 WP_001192973.1.63113 WP_001192973.1.63167 WP_001192973.1.63177 WP_001192973.1.63189 WP_001192973.1.6323 WP_001192973.1.63246 WP_001192973.1.6334 WP_001192973.1.6337 WP_001192973.1.63370 WP_001192973.1.63374 WP_001192973.1.63393 WP_001192973.1.63453 WP_001192973.1.63466 WP_001192973.1.63478 WP_001192973.1.6348 WP_001192973.1.63491 WP_001192973.1.63556 WP_001192973.1.63576 WP_001192973.1.63602 WP_001192973.1.63604 WP_001192973.1.63608 WP_001192973.1.63666 WP_001192973.1.63679 WP_001192973.1.63683 WP_001192973.1.63703 WP_001192973.1.63721 WP_001192973.1.63746 WP_001192973.1.63800 WP_001192973.1.63810 WP_001192973.1.63821 WP_001192973.1.63856 WP_001192973.1.63964 WP_001192973.1.63969 WP_001192973.1.63990 WP_001192973.1.64008 WP_001192973.1.64040 WP_001192973.1.64080 WP_001192973.1.64110 WP_001192973.1.6416 WP_001192973.1.64175 WP_001192973.1.64193 WP_001192973.1.64280 WP_001192973.1.64285 WP_001192973.1.64286 WP_001192973.1.64321 WP_001192973.1.64337 WP_001192973.1.64355 WP_001192973.1.64391 WP_001192973.1.6441 WP_001192973.1.64448 WP_001192973.1.64458 WP_001192973.1.64519 WP_001192973.1.64528 WP_001192973.1.64563 WP_001192973.1.64657 WP_001192973.1.64693 WP_001192973.1.64707 WP_001192973.1.64746 WP_001192973.1.64749 WP_001192973.1.64789 WP_001192973.1.64866 WP_001192973.1.64881 WP_001192973.1.64901 WP_001192973.1.64912 WP_001192973.1.64926 WP_001192973.1.64939 WP_001192973.1.64970 WP_001192973.1.6499 WP_001192973.1.64990 WP_001192973.1.65023 WP_001192973.1.65040 WP_001192973.1.65097 WP_001192973.1.651 WP_001192973.1.65110 WP_001192973.1.65151 WP_001192973.1.65155 WP_001192973.1.65179 WP_001192973.1.65206 WP_001192973.1.65256 WP_001192973.1.65271 WP_001192973.1.65296 WP_001192973.1.65306 WP_001192973.1.65353 WP_001192973.1.65364 WP_001192973.1.6537 WP_001192973.1.65370 WP_001192973.1.654 WP_001192973.1.65408 WP_001192973.1.65413 WP_001192973.1.65415 WP_001192973.1.65493 WP_001192973.1.6553 WP_001192973.1.65531 WP_001192973.1.6563 WP_001192973.1.65672 WP_001192973.1.65762 WP_001192973.1.65912 WP_001192973.1.65954 WP_001192973.1.65961 WP_001192973.1.65976 WP_001192973.1.6599 WP_001192973.1.65991 WP_001192973.1.66001 WP_001192973.1.66007 WP_001192973.1.66016 WP_001192973.1.66094 WP_001192973.1.66104 WP_001192973.1.66121 WP_001192973.1.66127 WP_001192973.1.66187 WP_001192973.1.66197 WP_001192973.1.66251 WP_001192973.1.66280 WP_001192973.1.66389 WP_001192973.1.66395 WP_001192973.1.66432 WP_001192973.1.66448 WP_001192973.1.6645 WP_001192973.1.66550 WP_001192973.1.66559 WP_001192973.1.66579 WP_001192973.1.66624 WP_001192973.1.66644 WP_001192973.1.66700 WP_001192973.1.66719 WP_001192973.1.66758 WP_001192973.1.6676 WP_001192973.1.66783 WP_001192973.1.66794 WP_001192973.1.66795 WP_001192973.1.66796 WP_001192973.1.66849 WP_001192973.1.66933 WP_001192973.1.66948 WP_001192973.1.67021 WP_001192973.1.67022 WP_001192973.1.67026 WP_001192973.1.67035 WP_001192973.1.6706 WP_001192973.1.67120 WP_001192973.1.67137 WP_001192973.1.67149 WP_001192973.1.67158 WP_001192973.1.67194 WP_001192973.1.67200 WP_001192973.1.67209 WP_001192973.1.67210 WP_001192973.1.67272 WP_001192973.1.67293 WP_001192973.1.67383 WP_001192973.1.67415 WP_001192973.1.67451 WP_001192973.1.67452 WP_001192973.1.67454 WP_001192973.1.67456 WP_001192973.1.67522 WP_001192973.1.67549 WP_001192973.1.67581 WP_001192973.1.67660 WP_001192973.1.67663 WP_001192973.1.67701 WP_001192973.1.67724 WP_001192973.1.67732 WP_001192973.1.67786 WP_001192973.1.67787 WP_001192973.1.67788 WP_001192973.1.678 WP_001192973.1.67810 WP_001192973.1.67841 WP_001192973.1.67853 WP_001192973.1.6793 WP_001192973.1.67971 WP_001192973.1.67975 WP_001192973.1.67990 WP_001192973.1.67999 WP_001192973.1.68008 WP_001192973.1.68011 WP_001192973.1.68012 WP_001192973.1.6802 WP_001192973.1.68025 WP_001192973.1.6803 WP_001192973.1.68039 WP_001192973.1.68069 WP_001192973.1.68070 WP_001192973.1.68079 WP_001192973.1.68138 WP_001192973.1.68170 WP_001192973.1.68200 WP_001192973.1.68215 WP_001192973.1.68278 WP_001192973.1.68283 WP_001192973.1.68336 WP_001192973.1.68341 WP_001192973.1.68347 WP_001192973.1.68395 WP_001192973.1.68396 WP_001192973.1.68490 WP_001192973.1.68566 WP_001192973.1.68635 WP_001192973.1.68695 WP_001192973.1.68697 WP_001192973.1.68711 WP_001192973.1.68750 WP_001192973.1.68751 WP_001192973.1.6877 WP_001192973.1.68797 WP_001192973.1.68865 WP_001192973.1.68873 WP_001192973.1.68880 WP_001192973.1.68915 WP_001192973.1.68924 WP_001192973.1.68956 WP_001192973.1.68961 WP_001192973.1.69033 WP_001192973.1.69098 WP_001192973.1.69126 WP_001192973.1.69127 WP_001192973.1.69144 WP_001192973.1.6916 WP_001192973.1.69160 WP_001192973.1.6921 WP_001192973.1.69221 WP_001192973.1.6923 WP_001192973.1.69247 WP_001192973.1.69258 WP_001192973.1.69305 WP_001192973.1.69390 WP_001192973.1.694 WP_001192973.1.69441 WP_001192973.1.6945 WP_001192973.1.69472 WP_001192973.1.69473 WP_001192973.1.69551 WP_001192973.1.69583 WP_001192973.1.69589 WP_001192973.1.69593 WP_001192973.1.69596 WP_001192973.1.69605 WP_001192973.1.69646 WP_001192973.1.69649 WP_001192973.1.69655 WP_001192973.1.69735 WP_001192973.1.69803 WP_001192973.1.69887 WP_001192973.1.69972 WP_001192973.1.70041 WP_001192973.1.70063 WP_001192973.1.70081 WP_001192973.1.7013 WP_001192973.1.70149 WP_001192973.1.70190 WP_001192973.1.70200 WP_001192973.1.70357 WP_001192973.1.70370 WP_001192973.1.70407 WP_001192973.1.70477 WP_001192973.1.70492 WP_001192973.1.7052 WP_001192973.1.70530 WP_001192973.1.70578 WP_001192973.1.70592 WP_001192973.1.70597 WP_001192973.1.70600 WP_001192973.1.70619 WP_001192973.1.70694 WP_001192973.1.70698 WP_001192973.1.70705 WP_001192973.1.70747 WP_001192973.1.70748 WP_001192973.1.70794 WP_001192973.1.70880 WP_001192973.1.7090 WP_001192973.1.70900 WP_001192973.1.70952 WP_001192973.1.71024 WP_001192973.1.71042 WP_001192973.1.71062 WP_001192973.1.71144 WP_001192973.1.71147 WP_001192973.1.71159 WP_001192973.1.71176 WP_001192973.1.71192 WP_001192973.1.71199 WP_001192973.1.71221 WP_001192973.1.71272 WP_001192973.1.71285 WP_001192973.1.71315 WP_001192973.1.71323 WP_001192973.1.71327 WP_001192973.1.71339 WP_001192973.1.71354 WP_001192973.1.71397 WP_001192973.1.71421 WP_001192973.1.71522 WP_001192973.1.71537 WP_001192973.1.71540 WP_001192973.1.71603 WP_001192973.1.71632 WP_001192973.1.71695 WP_001192973.1.71712 WP_001192973.1.71767 WP_001192973.1.71783 WP_001192973.1.71832 WP_001192973.1.71837 WP_001192973.1.71856 WP_001192973.1.71922 WP_001192973.1.71938 WP_001192973.1.71939 WP_001192973.1.71940 WP_001192973.1.71944 WP_001192973.1.71975 WP_001192973.1.71987 WP_001192973.1.71993 WP_001192973.1.71995 WP_001192973.1.72021 WP_001192973.1.72033 WP_001192973.1.7205 WP_001192973.1.72053 WP_001192973.1.72090 WP_001192973.1.7210 WP_001192973.1.72126 WP_001192973.1.72153 WP_001192973.1.72155 WP_001192973.1.72157 WP_001192973.1.72161 WP_001192973.1.72208 WP_001192973.1.72240 WP_001192973.1.72248 WP_001192973.1.7225 WP_001192973.1.72261 WP_001192973.1.72397 WP_001192973.1.72414 WP_001192973.1.72485 WP_001192973.1.72521 WP_001192973.1.72535 WP_001192973.1.72537 WP_001192973.1.72544 WP_001192973.1.72582 WP_001192973.1.72593 WP_001192973.1.72606 WP_001192973.1.72608 WP_001192973.1.72615 WP_001192973.1.72616 WP_001192973.1.72643 WP_001192973.1.72652 WP_001192973.1.72694 WP_001192973.1.72695 WP_001192973.1.72725 WP_001192973.1.72729 WP_001192973.1.72745 WP_001192973.1.72751 WP_001192973.1.72758 WP_001192973.1.72764 WP_001192973.1.72778 WP_001192973.1.72806 WP_001192973.1.72837 WP_001192973.1.72860 WP_001192973.1.72869 WP_001192973.1.72893 WP_001192973.1.72910 WP_001192973.1.72947 WP_001192973.1.72956 WP_001192973.1.73000 WP_001192973.1.73061 WP_001192973.1.7307 WP_001192973.1.73072 WP_001192973.1.73085 WP_001192973.1.73129 WP_001192973.1.73197 WP_001192973.1.73230 WP_001192973.1.73243 WP_001192973.1.73249 WP_001192973.1.73251 WP_001192973.1.73257 WP_001192973.1.73259 WP_001192973.1.73277 WP_001192973.1.73283 WP_001192973.1.73292 WP_001192973.1.73295 WP_001192973.1.73340 WP_001192973.1.73349 WP_001192973.1.73385 WP_001192973.1.7349 WP_001192973.1.73498 WP_001192973.1.73524 WP_001192973.1.73631 WP_001192973.1.73700 WP_001192973.1.73717 WP_001192973.1.73743 WP_001192973.1.7376 WP_001192973.1.73807 WP_001192973.1.73811 WP_001192973.1.73827 WP_001192973.1.73835 WP_001192973.1.73843 WP_001192973.1.73844 WP_001192973.1.73846 WP_001192973.1.73859 WP_001192973.1.73882 WP_001192973.1.73897 WP_001192973.1.73908 WP_001192973.1.73942 WP_001192973.1.73995 WP_001192973.1.73996 WP_001192973.1.74045 WP_001192973.1.74053 WP_001192973.1.7413 WP_001192973.1.74156 WP_001192973.1.74184 WP_001192973.1.74223 WP_001192973.1.7424 WP_001192973.1.74243 WP_001192973.1.7425 WP_001192973.1.74309 WP_001192973.1.74365 WP_001192973.1.74367 WP_001192973.1.74423 WP_001192973.1.74444 WP_001192973.1.74445 WP_001192973.1.74478 WP_001192973.1.74491 WP_001192973.1.74501 WP_001192973.1.74513 WP_001192973.1.74520 WP_001192973.1.74528 WP_001192973.1.7461 WP_001192973.1.74625 WP_001192973.1.74631 WP_001192973.1.74652 WP_001192973.1.74670 WP_001192973.1.74687 WP_001192973.1.74688 WP_001192973.1.74689 WP_001192973.1.74691 WP_001192973.1.74705 WP_001192973.1.74720 WP_001192973.1.74735 WP_001192973.1.7475 WP_001192973.1.7478 WP_001192973.1.7479 WP_001192973.1.74793 WP_001192973.1.74811 WP_001192973.1.74852 WP_001192973.1.74854 WP_001192973.1.74860 WP_001192973.1.74879 WP_001192973.1.74880 WP_001192973.1.74889 WP_001192973.1.74895 WP_001192973.1.74962 WP_001192973.1.74975 WP_001192973.1.74993 WP_001192973.1.75021 WP_001192973.1.75029 WP_001192973.1.75030 WP_001192973.1.75050 WP_001192973.1.75136 WP_001192973.1.75143 WP_001192973.1.75145 WP_001192973.1.75149 WP_001192973.1.75155 WP_001192973.1.75181 WP_001192973.1.75209 WP_001192973.1.75218 WP_001192973.1.75243 WP_001192973.1.75254 WP_001192973.1.75270 WP_001192973.1.75272 WP_001192973.1.75306 WP_001192973.1.75360 WP_001192973.1.75367 WP_001192973.1.75382 WP_001192973.1.75428 WP_001192973.1.75465 WP_001192973.1.75491 WP_001192973.1.75515 WP_001192973.1.75529 WP_001192973.1.75537 WP_001192973.1.75568 WP_001192973.1.75594 WP_001192973.1.75644 WP_001192973.1.75672 WP_001192973.1.75679 WP_001192973.1.75687 WP_001192973.1.75696 WP_001192973.1.75699 WP_001192973.1.75725 WP_001192973.1.75735 WP_001192973.1.75758 WP_001192973.1.75767 WP_001192973.1.75922 WP_001192973.1.7597 WP_001192973.1.75973 WP_001192973.1.75995 WP_001192973.1.75999 WP_001192973.1.76005 WP_001192973.1.76009 WP_001192973.1.76087 WP_001192973.1.76118 WP_001192973.1.76119 WP_001192973.1.76129 WP_001192973.1.76184 WP_001192973.1.76196 WP_001192973.1.76312 WP_001192973.1.76361 WP_001192973.1.7637 WP_001192973.1.76376 WP_001192973.1.76384 WP_001192973.1.76387 WP_001192973.1.76390 WP_001192973.1.76452 WP_001192973.1.76547 WP_001192973.1.76595 WP_001192973.1.7661 WP_001192973.1.76643 WP_001192973.1.76656 WP_001192973.1.76701 WP_001192973.1.76707 WP_001192973.1.76712 WP_001192973.1.7680 WP_001192973.1.76815 WP_001192973.1.76831 WP_001192973.1.76840 WP_001192973.1.76909 WP_001192973.1.76918 WP_001192973.1.76933 WP_001192973.1.76948 WP_001192973.1.76965 WP_001192973.1.77015 WP_001192973.1.77070 WP_001192973.1.77134 WP_001192973.1.77147 WP_001192973.1.77162 WP_001192973.1.77173 WP_001192973.1.77175 WP_001192973.1.77255 WP_001192973.1.7728 WP_001192973.1.77284 WP_001192973.1.77288 WP_001192973.1.77290 WP_001192973.1.77291 WP_001192973.1.77296 WP_001192973.1.7731 WP_001192973.1.77326 WP_001192973.1.77448 WP_001192973.1.77452 WP_001192973.1.77462 WP_001192973.1.77470 WP_001192973.1.775 WP_001192973.1.77503 WP_001192973.1.77542 WP_001192973.1.77577 WP_001192973.1.77595 WP_001192973.1.77632 WP_001192973.1.77636 WP_001192973.1.77648 WP_001192973.1.77741 WP_001192973.1.77767 WP_001192973.1.77768 WP_001192973.1.7781 WP_001192973.1.77876 WP_001192973.1.77929 WP_001192973.1.77949 WP_001192973.1.77999 WP_001192973.1.78000 WP_001192973.1.78007 WP_001192973.1.7808 WP_001192973.1.78089 WP_001192973.1.78097 WP_001192973.1.78099 WP_001192973.1.78101 WP_001192973.1.78102 WP_001192973.1.78188 WP_001192973.1.78196 WP_001192973.1.78202 WP_001192973.1.78233 WP_001192973.1.78235 WP_001192973.1.78297 WP_001192973.1.78321 WP_001192973.1.78368 WP_001192973.1.78445 WP_001192973.1.78453 WP_001192973.1.78462 WP_001192973.1.7847 WP_001192973.1.78477 WP_001192973.1.78481 WP_001192973.1.78515 WP_001192973.1.78527 WP_001192973.1.78581 WP_001192973.1.78583 WP_001192973.1.78586 WP_001192973.1.78610 WP_001192973.1.78612 WP_001192973.1.78645 WP_001192973.1.78683 WP_001192973.1.78696 WP_001192973.1.78706 WP_001192973.1.78718 WP_001192973.1.78746 WP_001192973.1.78750 WP_001192973.1.78791 WP_001192973.1.7883 WP_001192973.1.78854 WP_001192973.1.78888 WP_001192973.1.78891 WP_001192973.1.78953 WP_001192973.1.78966 WP_001192973.1.7898 WP_001192973.1.78996 WP_001192973.1.79004 WP_001192973.1.7901 WP_001192973.1.79067 WP_001192973.1.79086 WP_001192973.1.79092 WP_001192973.1.79126 WP_001192973.1.79137 WP_001192973.1.79159 WP_001192973.1.79233 WP_001192973.1.79246 WP_001192973.1.79248 WP_001192973.1.79249 WP_001192973.1.79306 WP_001192973.1.79343 WP_001192973.1.79346 WP_001192973.1.79356 WP_001192973.1.79369 WP_001192973.1.7937 WP_001192973.1.79389 WP_001192973.1.79391 WP_001192973.1.79478 WP_001192973.1.79519 WP_001192973.1.7952 WP_001192973.1.79525 WP_001192973.1.79526 WP_001192973.1.79540 WP_001192973.1.79558 WP_001192973.1.79591 WP_001192973.1.79640 WP_001192973.1.79685 WP_001192973.1.79759 WP_001192973.1.79800 WP_001192973.1.79816 WP_001192973.1.79840 WP_001192973.1.7985 WP_001192973.1.79866 WP_001192973.1.79869 WP_001192973.1.7987 WP_001192973.1.79877 WP_001192973.1.79905 WP_001192973.1.7993 WP_001192973.1.79930 WP_001192973.1.79932 WP_001192973.1.79936 WP_001192973.1.79944 WP_001192973.1.79952 WP_001192973.1.79984 WP_001192973.1.79995 WP_001192973.1.80011 WP_001192973.1.8004 WP_001192973.1.80050 WP_001192973.1.80060 WP_001192973.1.8007 WP_001192973.1.80071 WP_001192973.1.80106 WP_001192973.1.80112 WP_001192973.1.80179 WP_001192973.1.80183 WP_001192973.1.80255 WP_001192973.1.80292 WP_001192973.1.80310 WP_001192973.1.80320 WP_001192973.1.80388 WP_001192973.1.80402 WP_001192973.1.80426 WP_001192973.1.80428 WP_001192973.1.80440 WP_001192973.1.80484 WP_001192973.1.80517 WP_001192973.1.80519 WP_001192973.1.80524 WP_001192973.1.8057 WP_001192973.1.80612 WP_001192973.1.80662 WP_001192973.1.8068 WP_001192973.1.80718 WP_001192973.1.80724 WP_001192973.1.80736 WP_001192973.1.80737 WP_001192973.1.80753 WP_001192973.1.80754 WP_001192973.1.80756 WP_001192973.1.80789 WP_001192973.1.808 WP_001192973.1.80804 WP_001192973.1.80805 WP_001192973.1.80843 WP_001192973.1.80862 WP_001192973.1.80882 WP_001192973.1.8090 WP_001192973.1.80983 WP_001192973.1.80985 WP_001192973.1.81026 WP_001192973.1.81034 WP_001192973.1.81054 WP_001192973.1.81104 WP_001192973.1.81127 WP_001192973.1.81160 WP_001192973.1.81165 WP_001192973.1.8118 WP_001192973.1.81182 WP_001192973.1.8121 WP_001192973.1.81219 WP_001192973.1.81267 WP_001192973.1.81283 WP_001192973.1.81286 WP_001192973.1.8129 WP_001192973.1.81313 WP_001192973.1.81391 WP_001192973.1.81423 WP_001192973.1.81438 WP_001192973.1.81469 WP_001192973.1.81475 WP_001192973.1.81484 WP_001192973.1.81576 WP_001192973.1.81577 WP_001192973.1.81580 WP_001192973.1.81589 WP_001192973.1.81596 WP_001192973.1.81618 WP_001192973.1.81625 WP_001192973.1.81688 WP_001192973.1.81715 WP_001192973.1.8172 WP_001192973.1.81806 WP_001192973.1.81819 WP_001192973.1.81843 WP_001192973.1.81869 WP_001192973.1.81888 WP_001192973.1.81914 WP_001192973.1.81935 WP_001192973.1.81939 WP_001192973.1.81972 WP_001192973.1.82059 WP_001192973.1.82062 WP_001192973.1.82074 WP_001192973.1.82137 WP_001192973.1.82217 WP_001192973.1.82240 WP_001192973.1.82316 WP_001192973.1.82320 WP_001192973.1.82330 WP_001192973.1.8235 WP_001192973.1.82438 WP_001192973.1.82439 WP_001192973.1.82485 WP_001192973.1.82499 WP_001192973.1.82514 WP_001192973.1.82536 WP_001192973.1.82626 WP_001192973.1.82647 WP_001192973.1.82661 WP_001192973.1.82682 WP_001192973.1.82691 WP_001192973.1.82698 WP_001192973.1.82711 WP_001192973.1.82715 WP_001192973.1.82718 WP_001192973.1.82754 WP_001192973.1.82780 WP_001192973.1.82799 WP_001192973.1.82808 WP_001192973.1.82831 WP_001192973.1.82853 WP_001192973.1.82902 WP_001192973.1.82923 WP_001192973.1.83020 WP_001192973.1.83035 WP_001192973.1.83051 WP_001192973.1.8306 WP_001192973.1.8308 WP_001192973.1.83093 WP_001192973.1.83097 WP_001192973.1.831 WP_001192973.1.83140 WP_001192973.1.83214 WP_001192973.1.83224 WP_001192973.1.83330 WP_001192973.1.83347 WP_001192973.1.83415 WP_001192973.1.8345 WP_001192973.1.83481 WP_001192973.1.83537 WP_001192973.1.83544 WP_001192973.1.83564 WP_001192973.1.83584 WP_001192973.1.83660 WP_001192973.1.8368 WP_001192973.1.83706 WP_001192973.1.83735 WP_001192973.1.83762 WP_001192973.1.83781 WP_001192973.1.83820 WP_001192973.1.8384 WP_001192973.1.83879 WP_001192973.1.84004 WP_001192973.1.84060 WP_001192973.1.8411 WP_001192973.1.84172 WP_001192973.1.84185 WP_001192973.1.84210 WP_001192973.1.84298 WP_001192973.1.84313 WP_001192973.1.84319 WP_001192973.1.84331 WP_001192973.1.84339 WP_001192973.1.84405 WP_001192973.1.84467 WP_001192973.1.84511 WP_001192973.1.84518 WP_001192973.1.84534 WP_001192973.1.84584 WP_001192973.1.84668 WP_001192973.1.84675 WP_001192973.1.84697 WP_001192973.1.8470 WP_001192973.1.84731 WP_001192973.1.84740 WP_001192973.1.84797 WP_001192973.1.84841 WP_001192973.1.84850 WP_001192973.1.84875 WP_001192973.1.84877 WP_001192973.1.84878 WP_001192973.1.84894 WP_001192973.1.84916 WP_001192973.1.84929 WP_001192973.1.84948 WP_001192973.1.84966 WP_001192973.1.84972 WP_001192973.1.84977 WP_001192973.1.84989 WP_001192973.1.84994 WP_001192973.1.85002 WP_001192973.1.85011 WP_001192973.1.85052 WP_001192973.1.85090 WP_001192973.1.85098 WP_001192973.1.85105 WP_001192973.1.85106 WP_001192973.1.85112 WP_001192973.1.85129 WP_001192973.1.8517 WP_001192973.1.85175 WP_001192973.1.85216 WP_001192973.1.85241 WP_001192973.1.85247 WP_001192973.1.85255 WP_001192973.1.85260 WP_001192973.1.85323 WP_001192973.1.85361 WP_001192973.1.85435 WP_001192973.1.85500 WP_001192973.1.85525 WP_001192973.1.85563 WP_001192973.1.85601 WP_001192973.1.8564 WP_001192973.1.85657 WP_001192973.1.8579 WP_001192973.1.85793 WP_001192973.1.85806 WP_001192973.1.85857 WP_001192973.1.8592 WP_001192973.1.85939 WP_001192973.1.85948 WP_001192973.1.86 WP_001192973.1.86016 WP_001192973.1.8603 WP_001192973.1.8607 WP_001192973.1.86110 WP_001192973.1.86145 WP_001192973.1.86149 WP_001192973.1.86161 WP_001192973.1.86176 WP_001192973.1.86189 WP_001192973.1.86210 WP_001192973.1.86228 WP_001192973.1.86266 WP_001192973.1.86276 WP_001192973.1.86280 WP_001192973.1.86283 WP_001192973.1.86294 WP_001192973.1.86307 WP_001192973.1.8635 WP_001192973.1.86355 WP_001192973.1.86364 WP_001192973.1.86371 WP_001192973.1.86376 WP_001192973.1.86393 WP_001192973.1.86411 WP_001192973.1.86412 WP_001192973.1.86437 WP_001192973.1.86454 WP_001192973.1.86461 WP_001192973.1.86475 WP_001192973.1.86492 WP_001192973.1.86583 WP_001192973.1.86598 WP_001192973.1.86609 WP_001192973.1.86617 WP_001192973.1.86640 WP_001192973.1.86667 WP_001192973.1.86681 WP_001192973.1.86691 WP_001192973.1.86731 WP_001192973.1.86760 WP_001192973.1.86768 WP_001192973.1.86788 WP_001192973.1.8679 WP_001192973.1.86833 WP_001192973.1.86848 WP_001192973.1.8687 WP_001192973.1.86935 WP_001192973.1.86959 WP_001192973.1.86975 WP_001192973.1.86997 WP_001192973.1.87109 WP_001192973.1.8711 WP_001192973.1.87147 WP_001192973.1.87177 WP_001192973.1.87189 WP_001192973.1.87199 WP_001192973.1.87249 WP_001192973.1.87310 WP_001192973.1.87339 WP_001192973.1.87358 WP_001192973.1.87389 WP_001192973.1.87400 WP_001192973.1.87410 WP_001192973.1.87465 WP_001192973.1.87557 WP_001192973.1.87563 WP_001192973.1.87568 WP_001192973.1.87607 WP_001192973.1.87610 WP_001192973.1.87635 WP_001192973.1.87655 WP_001192973.1.87694 WP_001192973.1.87721 WP_001192973.1.87726 WP_001192973.1.87728 WP_001192973.1.87788 WP_001192973.1.87789 WP_001192973.1.87834 WP_001192973.1.87857 WP_001192973.1.87973 WP_001192973.1.87980 WP_001192973.1.87989 WP_001192973.1.87990 WP_001192973.1.880 WP_001192973.1.88017 WP_001192973.1.88020 WP_001192973.1.88110 WP_001192973.1.88149 WP_001192973.1.88155 WP_001192973.1.88238 WP_001192973.1.88285 WP_001192973.1.88301 WP_001192973.1.88376 WP_001192973.1.88379 WP_001192973.1.88427 WP_001192973.1.88434 WP_001192973.1.88462 WP_001192973.1.88505 WP_001192973.1.8854 WP_001192973.1.88598 WP_001192973.1.88603 WP_001192973.1.88607 WP_001192973.1.88646 WP_001192973.1.88667 WP_001192973.1.88678 WP_001192973.1.88709 WP_001192973.1.88710 WP_001192973.1.88717 WP_001192973.1.88720 WP_001192973.1.8873 WP_001192973.1.88757 WP_001192973.1.8879 WP_001192973.1.88834 WP_001192973.1.88950 WP_001192973.1.88953 WP_001192973.1.88997 WP_001192973.1.8906 WP_001192973.1.89090 WP_001192973.1.89099 WP_001192973.1.89163 WP_001192973.1.89165 WP_001192973.1.89197 WP_001192973.1.89200 WP_001192973.1.89255 WP_001192973.1.89305 WP_001192973.1.89335 WP_001192973.1.894 WP_001192973.1.89400 WP_001192973.1.89403 WP_001192973.1.89416 WP_001192973.1.89432 WP_001192973.1.8945 WP_001192973.1.89458 WP_001192973.1.89466 WP_001192973.1.89492 WP_001192973.1.89510 WP_001192973.1.89551 WP_001192973.1.89583 WP_001192973.1.89601 WP_001192973.1.89605 WP_001192973.1.89630 WP_001192973.1.89656 WP_001192973.1.89674 WP_001192973.1.89679 WP_001192973.1.89700 WP_001192973.1.89710 WP_001192973.1.89768 WP_001192973.1.89781 WP_001192973.1.89788 WP_001192973.1.89841 WP_001192973.1.89859 WP_001192973.1.89895 WP_001192973.1.89899 WP_001192973.1.89915 WP_001192973.1.89920 WP_001192973.1.89923 WP_001192973.1.89927 WP_001192973.1.89977 WP_001192973.1.90017 WP_001192973.1.90022 WP_001192973.1.90063 WP_001192973.1.90078 WP_001192973.1.9009 WP_001192973.1.9010 WP_001192973.1.90115 WP_001192973.1.90128 WP_001192973.1.90146 WP_001192973.1.90168 WP_001192973.1.90182 WP_001192973.1.90205 WP_001192973.1.90256 WP_001192973.1.90266 WP_001192973.1.90270 WP_001192973.1.90332 WP_001192973.1.90358 WP_001192973.1.9036 WP_001192973.1.90389 WP_001192973.1.90436 WP_001192973.1.90441 WP_001192973.1.90449 WP_001192973.1.90467 WP_001192973.1.90520 WP_001192973.1.90536 WP_001192973.1.90547 WP_001192973.1.9059 WP_001192973.1.90591 WP_001192973.1.90690 WP_001192973.1.90703 WP_001192973.1.90706 WP_001192973.1.90799 WP_001192973.1.9081 WP_001192973.1.90813 WP_001192973.1.90822 WP_001192973.1.90834 WP_001192973.1.90839 WP_001192973.1.90865 WP_001192973.1.90890 WP_001192973.1.90924 WP_001192973.1.90951 WP_001192973.1.90979 WP_001192973.1.90997 WP_001192973.1.91 WP_001192973.1.91007 WP_001192973.1.91018 WP_001192973.1.9104 WP_001192973.1.91113 WP_001192973.1.91117 WP_001192973.1.91121 WP_001192973.1.9118 WP_001192973.1.91213 WP_001192973.1.91268 WP_001192973.1.91277 WP_001192973.1.91290 WP_001192973.1.91340 WP_001192973.1.91341 WP_001192973.1.91361 WP_001192973.1.91445 WP_001192973.1.91462 WP_001192973.1.915 WP_001192973.1.91511 WP_001192973.1.91516 WP_001192973.1.91543 WP_001192973.1.91549 WP_001192973.1.91551 WP_001192973.1.9157 WP_001192973.1.91594 WP_001192973.1.91596 WP_001192973.1.91626 WP_001192973.1.91640 WP_001192973.1.91643 WP_001192973.1.91672 WP_001192973.1.91685 WP_001192973.1.9171 WP_001192973.1.91777 WP_001192973.1.91779 WP_001192973.1.91782 WP_001192973.1.91787 WP_001192973.1.91850 WP_001192973.1.91879 WP_001192973.1.91951 WP_001192973.1.91965 WP_001192973.1.92005 WP_001192973.1.92014 WP_001192973.1.92019 WP_001192973.1.92114 WP_001192973.1.92304 WP_001192973.1.92311 WP_001192973.1.92473 WP_001192973.1.92532 WP_001192973.1.92571 WP_001192973.1.92577 WP_001192973.1.92614 WP_001192973.1.92615 WP_001192973.1.92634 WP_001192973.1.9264 WP_001192973.1.9266 WP_001192973.1.92668 WP_001192973.1.92708 WP_001192973.1.92719 WP_001192973.1.92742 WP_001192973.1.92781 WP_001192973.1.92845 WP_001192973.1.92882 WP_001192973.1.92886 WP_001192973.1.92932 WP_001192973.1.92943 WP_001192973.1.92953 WP_001192973.1.93005 WP_001192973.1.93016 WP_001192973.1.93019 WP_001192973.1.93052 WP_001192973.1.93054 WP_001192973.1.93072 WP_001192973.1.93085 WP_001192973.1.93100 WP_001192973.1.93112 WP_001192973.1.93167 WP_001192973.1.93175 WP_001192973.1.93252 WP_001192973.1.9327 WP_001192973.1.93276 WP_001192973.1.9331 WP_001192973.1.93312 WP_001192973.1.93379 WP_001192973.1.93388 WP_001192973.1.93463 WP_001192973.1.93509 WP_001192973.1.9356 WP_001192973.1.93621 WP_001192973.1.93629 WP_001192973.1.93637 WP_001192973.1.93652 WP_001192973.1.93673 WP_001192973.1.93733 WP_001192973.1.93737 WP_001192973.1.93743 WP_001192973.1.93745 WP_001192973.1.93755 WP_001192973.1.93768 WP_001192973.1.93800 WP_001192973.1.93873 WP_001192973.1.93877 WP_001192973.1.939 WP_001192973.1.93900 WP_001192973.1.93911 WP_001192973.1.93918 WP_001192973.1.93921 WP_001192973.1.93951 WP_001192973.1.93971 WP_001192973.1.94011 WP_001192973.1.94025 WP_001192973.1.94035 WP_001192973.1.94156 WP_001192973.1.94176 WP_001192973.1.94187 WP_001192973.1.94271 WP_001192973.1.94298 WP_001192973.1.94353 WP_001192973.1.94388 WP_001192973.1.94404 WP_001192973.1.94430 WP_001192973.1.94445 WP_001192973.1.94542 WP_001192973.1.94548 WP_001192973.1.9457 WP_001192973.1.94578 WP_001192973.1.94626 WP_001192973.1.94692 WP_001192973.1.94695 WP_001192973.1.94738 WP_001192973.1.94739 WP_001192973.1.94754 WP_001192973.1.94764 WP_001192973.1.94787 WP_001192973.1.948 WP_001192973.1.94806 WP_001192973.1.94808 WP_001192973.1.94822 WP_001192973.1.94823 WP_001192973.1.94836 WP_001192973.1.94841 WP_001192973.1.94847 WP_001192973.1.94889 WP_001192973.1.9489 WP_001192973.1.949 WP_001192973.1.94903 WP_001192973.1.94927 WP_001192973.1.94934 WP_001192973.1.94935 WP_001192973.1.94938 WP_001192973.1.94949 WP_001192973.1.94993 WP_001192973.1.95005 WP_001192973.1.95062 WP_001192973.1.95198 WP_001192973.1.95244 WP_001192973.1.95275 WP_001192973.1.95332 WP_001192973.1.95368 WP_001192973.1.95381 WP_001192973.1.95390 WP_001192973.1.95400 WP_001192973.1.95403 WP_001192973.1.95424 WP_001192973.1.95438 WP_001192973.1.95490 WP_001192973.1.95518 WP_001192973.1.95521 WP_001192973.1.9559 WP_001192973.1.95595 WP_001192973.1.95596 WP_001192973.1.95611 WP_001192973.1.95634 WP_001192973.1.95680 WP_001192973.1.95771 WP_001192973.1.95800 WP_001192973.1.95824 WP_001192973.1.95827 WP_001192973.1.95849 WP_001192973.1.95865 WP_001192973.1.95869 WP_001192973.1.95916 WP_001192973.1.95919 WP_001192973.1.95932 WP_001192973.1.95951 WP_001192973.1.960 WP_001192973.1.96015 WP_001192973.1.96053 WP_001192973.1.96059 WP_001192973.1.96066 WP_001192973.1.96086 WP_001192973.1.96110 WP_001192973.1.96114 WP_001192973.1.96177 WP_001192973.1.96215 WP_001192973.1.96222 WP_001192973.1.96229 WP_001192973.1.96279 WP_001192973.1.96281 WP_001192973.1.96290 WP_001192973.1.96299 WP_001192973.1.96303 WP_001192973.1.9631 WP_001192973.1.96339 WP_001192973.1.96341 WP_001192973.1.96378 WP_001192973.1.96394 WP_001192973.1.96450 WP_001192973.1.96457 WP_001192973.1.96479 WP_001192973.1.96484 WP_001192973.1.96494 WP_001192973.1.965 WP_001192973.1.96541 WP_001192973.1.9657 WP_001192973.1.96585 WP_001192973.1.96609 WP_001192973.1.9661 WP_001192973.1.96617 WP_001192973.1.96659 WP_001192973.1.9668 WP_001192973.1.96753 WP_001192973.1.96779 WP_001192973.1.96820 WP_001192973.1.96850 WP_001192973.1.96894 WP_001192973.1.9690 WP_001192973.1.9691 WP_001192973.1.96936 WP_001192973.1.96944 WP_001192973.1.96971 WP_001192973.1.96984 WP_001192973.1.96989 WP_001192973.1.97049 WP_001192973.1.97059 WP_001192973.1.9708 WP_001192973.1.97119 WP_001192973.1.97123 WP_001192973.1.97160 WP_001192973.1.97200 WP_001192973.1.97231 WP_001192973.1.97238 WP_001192973.1.97247 WP_001192973.1.97248 WP_001192973.1.97351 WP_001192973.1.97356 WP_001192973.1.97360 WP_001192973.1.97379 WP_001192973.1.97418 WP_001192973.1.97421 WP_001192973.1.97439 WP_001192973.1.97459 WP_001192973.1.97464 WP_001192973.1.9747 WP_001192973.1.97538 WP_001192973.1.97560 WP_001192973.1.97619 WP_001192973.1.97667 WP_001192973.1.97675 WP_001192973.1.97685 WP_001192973.1.97705 WP_001192973.1.978 WP_001192973.1.97802 WP_001192973.1.97822 WP_001192973.1.97825 WP_001192973.1.97919 WP_001192973.1.97962 WP_001192973.1.97982 WP_001192973.1.97996 WP_001192973.1.98000 WP_001192973.1.98012 WP_001192973.1.98026 WP_001192973.1.9803 WP_001192973.1.98082 WP_001192973.1.98115 WP_001192973.1.98167 WP_001192973.1.98202 WP_001192973.1.98208 WP_001192973.1.98220 WP_001192973.1.98235 WP_001192973.1.98239 WP_001192973.1.98241 WP_001192973.1.98244 WP_001192973.1.98292 WP_001192973.1.98294 WP_001192973.1.98301 WP_001192973.1.98355 WP_001192973.1.98404 WP_001192973.1.98424 WP_001192973.1.98429 WP_001192973.1.98451 WP_001192973.1.98477 WP_001192973.1.98578 WP_001192973.1.9858 WP_001192973.1.98614 WP_001192973.1.98654 WP_001192973.1.98668 WP_001192973.1.98683 WP_001192973.1.98702 WP_001192973.1.98776 WP_001192973.1.98784 WP_001192973.1.98849 WP_001192973.1.98875 WP_001192973.1.98976 WP_001192973.1.99046 WP_001192973.1.99209 WP_001192973.1.99246 WP_001192973.1.99265 WP_001192973.1.99292 WP_001192973.1.99295 WP_001192973.1.99304 WP_001192973.1.99310 WP_001192973.1.99319 WP_001192973.1.99334 WP_001192973.1.99345 WP_001192973.1.99361 WP_001192973.1.99392 WP_001192973.1.9940 WP_001192973.1.99400 WP_001192973.1.99446 WP_001192973.1.99453 WP_001192973.1.99475 WP_001192973.1.99534 WP_001192973.1.99562 WP_001192973.1.99592 WP_001192973.1.99602 WP_001192973.1.99603 WP_001192973.1.99632 WP_001192973.1.99666 WP_001192973.1.99698 WP_001192973.1.99734 WP_001192973.1.99804 WP_001192973.1.99827 WP_001192973.1.99929 YP_002415289.1.14968 YP_006781228.1.12065 YP_405776.1.10455 gi|387623787|ref|YP_006131415.1| gi|471335627|ref|YP_007559104.1| gi|157156850|ref|YP_001465656.1| gi|387610040|ref|YP_006098896.1| gi|251787409|ref|YP_003001713.1| gi|386617066|ref|YP_006136732.1| 1kf6A gi|253775216|ref|YP_003038047.1| gi|443615672|ref|YP_007379528.1| gi|407467203|ref|YP_006786355.1| gi|209921647|ref|YP_002295731.1| gi|386712101|ref|YP_006175822.1| gi|238903264|ref|YP_002929060.1| gi|218556711|ref|YP_002389625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]