SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1kopA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kopA
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.33e-100
Family Carbonic anhydrase 0.000000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1kopA   PDB: 1kop   SUPERFAMILY: 1kopA
Sequence length 223
Comment (A:)
Sequence
hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie
Download sequence
Identical sequences 1kopA 000002349|e1kopA1|62.1.1.1|A:1-223 000044639|e1kopB1|62.1.1.1|B:1-223 cath|current|1kopA00/4-226 cath|current|1kopB00/4-226 cath|current|1koqA00/5-226 cath|current|1koqB00/6-226 d1kopa_ d1kopb_ 1kop_A 1kop_B 1koq_A 1koq_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]