SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ky5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ky5A
Domain Number 1 Region: 4-189,352-431
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 3.81e-121
Family S-adenosylhomocystein hydrolase 0.000000000512
Further Details:      
 
Domain Number 2 Region: 190-351
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.32e-78
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ky5A   PDB: 1ky5
Sequence length 431
Comment (A:)
Sequence
adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
ngpfkpdhyry
Download sequence
Identical sequences 1d4f_A 1d4f_B 1d4f_C 1d4f_D 1ky5_A 1ky5_B 1ky5_C 1ky5_D 1ky5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]