SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1l7dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1l7dA
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 2.24e-52
Family L-alanine dehydrogenase-like 0.000000194
Further Details:      
 
Domain Number 2 Region: 144-325
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.66e-42
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000283
Further Details:      
 
Domain Number 3 Region: 328-384
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 0.00000124
Family L-alanine dehydrogenase-like 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1l7dA   PDB: 1l7d
Sequence length 384
Comment (A:)
Sequence
MKIAIPKERRPGEDRVAISPEVVKKLVGLGFEVIVEQGAGVGASITDDALTAAGATIAST
AAQALSQADVVWKVQRPMTAEEGTDEVALIKEGAVLMCHLGALTNRPVVEALTKRKITAY
AMELMPRISRAQSMDILSSQSNLAGYRAVIDGAYEFARAFPMMMTAAGTVPPARVLVFGV
GVAGLQAIATAKRLGAVVMATDVRAATKEQVESLGGKFITVDDEAMKTAETAGGYAKEMG
EEFRKKQAEAVLKELVKTDIAITTALIPGKPAPVLITEEMVTKMKPGSVIIDLAVEAGGN
CPLSEPGKIVVKHGVKIVGHTNVPSRVAADASPLFAKNLLNFLTPHVDKDTKTLVMKLED
ETVSGTCVTRDGAIVHPALTGQGA
Download sequence
Identical sequences P0C186 Q2RSB2
gi|83593518|ref|YP_427270.1| 1l7dA 269796.Rru_A2183 1f8g_A 1f8g_B 1f8g_C 1f8g_D 1hzz_A 1hzz_B 1l7d_A 1l7d_B 1l7d_C 1l7d_D 1l7e_A 1l7e_B 1l7e_C 1l7e_D 1u28_A 1u28_B 1u2d_A 1u2d_B 1u2g_A 1u2g_B 1xlt_A 1xlt_B 1xlt_D 1xlt_E 1xlt_G 1xlt_H 2oo5_A 2oo5_B 2oor_A 2oor_B gi|386350262|ref|YP_006048510.1| WP_011390032.1.3410 YP_427270.1.57063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]