SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1lg5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lg5A
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.41e-142
Family Carbonic anhydrase 0.0000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lg5A   PDB: 1lg5   SUPERFAMILY: 1lg5A
Sequence length 260
Comment (A:)
Sequence
mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
nnghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
rgllpesldywtypgslptppllesvtwivlkepisvsseqvlkfrklnfngegepeelm
vdnwrpaqplknrqikasfk
Download sequence
Identical sequences 1lg5A 1lg5_A 1lg6_A 1lgd_A cath|current|1lg5A00/4-261 cath|current|1lg6A00/4-261 cath|current|1lgdA00/4-261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]