SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1lj1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lj1A
Domain Number 1 Region: 123-382,509-570
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.59e-60
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000594
Further Details:      
 
Domain Number 2 Region: 365-510
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.73e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000129
Further Details:      
 
Domain Number 3 Region: 6-92
Classification Level Classification E-value
Superfamily Multiheme cytochromes 4.84e-17
Family Di-heme elbow motif 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lj1A   PDB: 1lj1
Sequence length 571
Comment (A:)
Sequence
adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
yifahptlsvkggvmvteavrgngailvnregkrfvneittadkasaailaqtgksayli
fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
ganrlggnaisdiitfgrlageeaakyskkn
Download sequence
Identical sequences 1lj1A 1lj1_A 1lj1_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]