SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1lpfA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lpfA
Domain Number 1 Region: 352-461
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.99e-66
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000785
Further Details:      
 
Domain Number 2 Region: 2-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.05e-64
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lpfA   PDB: 1lpf
Sequence length 477
Comment (A:)
Sequence
sqkfdvvvigagpggyvaairaaqlglktaciekyigkegkvalggtclnvgcipskall
dssykyheakeafkvhgieakgvtidvpamvarkanivknltggiatlfkangvtsfegh
gkllankqvevtgldgktqvleaenviiasgsrpveippaplsddiivdstgalefqavp
kklgvigagviglelgsvwarlgaevtvlealdkflpaadeqiakealkvltkqglnirl
garvtasevkkkqvtvtftdangeqketfdklivavgrrpvttdllaadsgvtldergfi
yvddhcktsvpgvfaigdvvrgamlahkaseegvmvaeriaghkaqmnydlipsviythp
eiawvgkteqtlkaegvevnvgtfpfaasgramaandttglvkviadaktdrvlgvhvig
psaaelvqqgaigmefgtsaedlgmmvfshptlsealheaalavnghaihianrkkr
Download sequence
Identical sequences 1lpf_A 1lpf_B 1lpfA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]