SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1lugA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1lugA
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.49e-144
Family Carbonic anhydrase 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1lugA   PDB: 1lug   SUPERFAMILY: 1lugA
Sequence length 259
Comment (A:)
Sequence
shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
dnwrpaqplknrqikasfk
Download sequence
Identical sequences 1lugA 000002346|e1lugA1|62.1.1.1|A:1-259 000149200|e3v7xA1|62.1.1.1|A:1-259 000151866|e4fl7A1|62.1.1.1|A:1-259 000386153|e3igpA1|62.1.1.1|A:2-260 001680742|e4z1eA1|62.1.1.1|A:1-259 001838922|e5a6hA1|62.1.1.1|A:2-260 002033922|e5l3oA1|62.1.1.1|A:2-260 002033923|e5l3oB1|62.1.1.1|B:2-260 002033924|e5l6kA1|62.1.1.1|A:2-260 002033925|e5l6kB1|62.1.1.1|B:2-260 002036834|e5lvsA1|62.1.1.1|A:1-259 002036835|e5lvsB1|62.1.1.1|B:1-259 002087065|e5l9eA1|62.1.1.1|A:2-260 002087066|e5l9eB1|62.1.1.1|B:2-260 002101039|e5ll4B1|62.1.1.1|B:2-260 cath|current|1a42A00/4-260 cath|current|1am6A00/3-261 cath|current|1avnA00/4-261 cath|current|1bcdA00/3-261 cath|current|1bn1A00/4-261 cath|current|1bn3A00/4-261 cath|current|1bn4A00/4-261 cath|current|1bnmA00/4-261 cath|current|1bnnA00/4-261 cath|current|1bnqA00/4-260 cath|current|1bntA00/4-260 cath|current|1bnuA00/4-260 cath|current|1bnvA00/4-261 cath|current|1bnwA00/4-260 cath|current|1bv3A00/4-261 cath|current|1ca2A00/4-260 cath|current|1cahA00/3-261 cath|current|1cayA00/3-261 cath|current|1cilA00/4-260 cath|current|1cimA00/4-260 cath|current|1cinA00/4-260 cath|current|1f2wA00/4-261 cath|current|1g1dA00/3-261 cath|current|1g52A00/3-261 cath|current|1g53A00/3-261 cath|current|1g54A00/3-261 cath|current|1i8zA00/3-261 cath|current|1i90A00/3-261 cath|current|1i91A00/3-261 cath|current|1if4A00/3-261 cath|current|1if5A00/3-261 cath|current|1if6A00/3-261 cath|current|1if7A00/3-261 cath|current|1if8A00/3-261 cath|current|1if9A00/3-261 cath|current|1lugA00/2-260 cath|current|1oklA00/5-259 cath|current|1okmA00/4-261 cath|current|1oknA00/5-261 cath|current|1oq5A00/4-260 cath|current|1rayA00/3-261 cath|current|1razA00/3-261 cath|current|1rzaA00/3-261 cath|current|1rzbA00/3-261 cath|current|1rzcA00/3-261 cath|current|1rzdA00/3-261 cath|current|1rzeA00/3-261 cath|current|1ttmA00/3-261 cath|current|1xq0A00/3-261 cath|current|1z9yA00/4-260 cath|current|1ze8A00/3-261 cath|current|1zfkA00/1004-1260 cath|current|1zfqA00/4-260 cath|current|1zgeA00/4-260 cath|current|1zgfA00/4-260 cath|current|2abeA00/4-261 cath|current|2aw1A00/3-260 cath|current|2ca2A00/4-260 cath|current|2f14A00/4-261 cath|current|2gd8A00/4-261 cath|current|2hd6A00/3-260 cath|current|2hl4A00/3-260 cath|current|2hncA00/4-261 cath|current|2hocA00/3-261 cath|current|2iliA00/3-261 cath|current|2osfA00/4-260 cath|current|2osmA00/3-260 cath|current|2qo8A00/2-261 cath|current|2qoaA00/4-261 cath|current|2qp6A00/3-261 cath|current|2wd2A00/3-261 cath|current|2wd3A00/4-260 cath|current|2wegA00/3-261 cath|current|2wehA00/3-261 cath|current|2wejA00/3-261 cath|current|2weoA00/4-261 cath|current|2x7sA00/4-260 cath|current|2x7tA00/4-260 cath|current|2x7uA00/4-260 cath|current|3betA00/3-261 cath|current|3ca2A00/4-260 cath|current|3gz0A00/4-261 cath|current|3ibiA00/3-260 cath|current|3iblA00/3-261 cath|current|3ibnA00/3-261 cath|current|3ibuA00/3-261 cath|current|3mnuA00/4-261 cath|current|3po6A00/3-261 cath|current|3ryjB00/4-261 cath|current|3ryxB00/3-261 cath|current|3ryzA00/3-261 cath|current|3rz0B00/3-261 cath|current|3rz1B00/4-261 cath|current|3rz5A00/3-261 cath|current|3rz7A00/4-261 cath|current|3rz8A00/4-261 cath|current|3t5uA00/4-261 cath|current|3t5zA00/3-261 cath|current|3v7xA00/1003-1261 cath|current|3vbdA00/1003-1261 cath|current|4bf1A00/4-261 cath|current|4bf6A00/4-261 cath|current|4cacA00/4-260 cath|current|4fl7A00/4-261 cath|current|4qy3A00/4-261 cath|current|5cacA00/4-260 d1cana_ d1caoa_ d1craa_ d1luga_ d1xevb_ d1xevc_ d2fosa_ d2fova_ d2nnoa_ d2nnsa_ d2nnva_ d2qo8a_ d3igpa_ d3sbha_ d4z1ea_ d5a6ha_ d5l3oa_ d5l3ob_ d5l6ka_ d5l6kb_ d5l9ea_ d5l9eb_ d5lvsa_ d5lvsb_ 1a42_A 1am6_A 1avn_A 1bcd_A 1bn1_A 1bn3_A 1bn4_A 1bnm_A 1bnn_A 1bnq_A 1bnt_A 1bnu_A 1bnv_A 1bnw_A 1bv3_A 1ca2_A 1cah_A 1cay_A 1cil_A 1cim_A 1cin_A 1f2w_A 1g1d_A 1g52_A 1g53_A 1g54_A 1i8z_A 1i90_A 1i91_A 1if4_A 1if5_A 1if6_A 1if7_A 1if8_A 1if9_A 1lug_A 1okl_A 1okm_A 1okn_A 1oq5_A 1ray_A 1raz_A 1rza_A 1rzb_A 1rzc_A 1rzd_A 1rze_A 1ttm_A 1xq0_A 1z9y_A 1ze8_A 1zfk_A 1zfq_A 1zge_A 1zgf_A 2abe_A 2aw1_A 2ca2_A 2f14_A 2gd8_A 2hd6_A 2hl4_A 2hnc_A 2hoc_A 2ili_A 2osf_A 2osm_A 2qo8_A 2qoa_A 2qp6_A 2wd2_A 2wd3_A 2weg_A 2weh_A 2wej_A 2weo_A 2x7s_A 2x7t_A 2x7u_A 3bet_A 3ca2_A 3gz0_A 3ibi_A 3ibl_A 3ibn_A 3ibu_A 3mnu_A 3po6_A 3ryj_B 3ryx_B 3ryz_A 3rz0_B 3rz1_B 3rz5_A 3rz7_A 3rz8_A 3t5u_A 3t5z_A 3v7x_A 3vbd_A 4bf1_A 4bf6_A 4cac_A 4fl7_A 4qy3_A 4yvy_A 4z1e_A 5amd_A 5amg_A 5aml_A 5cac_A 5lvs_A 5lvs_B 5mjn_A 6ceh_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]