SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1m6iA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1m6iA
Domain Number 1 Region: 358-488
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.67e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 7-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.16e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000466
Further Details:      
 
Domain Number 3 Region: 179-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1m6iA   PDB: 1m6i
Sequence length 493
Comment (A:)
Sequence
eevpqdkapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelw
fsddpnvtktlrfkqwngkersiyfqppsfyvsaqdlphienggvavltgkkvvqldvrd
nmvklndgsqityekcliatggtprslsaidragaevksrttlfrkigdfrslekisrev
ksitiigggflgselacalgrkaralgteviqlfpekgnmgkilpeylsnwtmekvrreg
vkvmpnaivqsvgvssgklliklkdgrkvetdhivaavglepnvelaktggleidsdfgg
frvnaelqarsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqs
mfwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirsesetesease
itippstpavpqapvqgedygkgvifylrdkvvvgivlwnifnrmpiarkiikdgeqhed
lnevaklfnihed
Download sequence
Identical sequences 1m6iA 1m6i_A 4bv6_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]